Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4FAD0

Protein Details
Accession A0A0C4FAD0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-25ESGPSRKMVKIKPQDRNLKFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9, cyto 6.5, pero 5, mito 4
Family & Domain DBs
Amino Acid Sequences MDTPQESGPSRKMVKIKPQDRNLKFTGTRVEAFLRQYELAANLDGASDEDKVLQIPSFLGSEDIQDAVWDMSGYATKSWAVLREQMVERWGQVDIVRYTAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.6
3 0.67
4 0.69
5 0.76
6 0.81
7 0.78
8 0.77
9 0.69
10 0.66
11 0.57
12 0.5
13 0.47
14 0.4
15 0.37
16 0.32
17 0.32
18 0.27
19 0.28
20 0.26
21 0.21
22 0.17
23 0.16
24 0.15
25 0.13
26 0.12
27 0.1
28 0.09
29 0.07
30 0.06
31 0.06
32 0.06
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.05
44 0.05
45 0.05
46 0.07
47 0.06
48 0.07
49 0.08
50 0.08
51 0.06
52 0.06
53 0.07
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.06
60 0.07
61 0.06
62 0.07
63 0.07
64 0.08
65 0.1
66 0.12
67 0.13
68 0.17
69 0.19
70 0.24
71 0.26
72 0.27
73 0.27
74 0.25
75 0.23
76 0.2
77 0.18
78 0.13
79 0.12
80 0.17
81 0.16