Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EM73

Protein Details
Accession A0A0C4EM73   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
72-99QTKHCKQSSSTPKPKRPQPQRANNPGMTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MDSTANFTPSHPAGLEVTPSWTLMDTASPSQQPVTTLKSPFPDPAPKRQRGLQMKPNSSKEIATSSDEEPIQTKHCKQSSSTPKPKRPQPQRANNPGMTADHSSSARLSRRIADSVGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.16
4 0.18
5 0.16
6 0.16
7 0.15
8 0.12
9 0.12
10 0.1
11 0.11
12 0.1
13 0.12
14 0.14
15 0.14
16 0.14
17 0.15
18 0.15
19 0.15
20 0.15
21 0.2
22 0.22
23 0.23
24 0.25
25 0.27
26 0.28
27 0.28
28 0.29
29 0.32
30 0.31
31 0.4
32 0.47
33 0.48
34 0.49
35 0.52
36 0.57
37 0.56
38 0.61
39 0.59
40 0.6
41 0.63
42 0.66
43 0.65
44 0.57
45 0.49
46 0.42
47 0.33
48 0.27
49 0.22
50 0.18
51 0.18
52 0.16
53 0.18
54 0.18
55 0.17
56 0.15
57 0.15
58 0.16
59 0.17
60 0.19
61 0.24
62 0.27
63 0.28
64 0.29
65 0.39
66 0.46
67 0.54
68 0.62
69 0.64
70 0.71
71 0.78
72 0.85
73 0.85
74 0.84
75 0.85
76 0.85
77 0.86
78 0.88
79 0.9
80 0.88
81 0.79
82 0.7
83 0.6
84 0.51
85 0.44
86 0.37
87 0.28
88 0.23
89 0.22
90 0.21
91 0.21
92 0.25
93 0.26
94 0.25
95 0.27
96 0.29
97 0.34
98 0.35