FuNGI

A0A0C4ELF0

Protein Details

Accession

A0A0C4ELF0

Localization Confidence

Low

Confidence Score

6.9

NoLS Segment(s)

Position	Sequence	Protein Nature
90-118	TYRVRCVQFHQRKTQQSRAKKHGSKRDFW	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

pero 9, cyto_nucl 8.5, cyto 7.5, nucl 6.5, mito 2

Family & Domain DBs

InterPro	View protein in InterPro IPR001117 Cu-oxidase_2nd IPR011706 Cu-oxidase_C IPR045087 Cu-oxidase_fam IPR008972 Cupredoxin
Gene Ontology	GO:0005507 F:copper ion binding GO:0016491 F:oxidoreductase activity
Pfam	View protein in Pfam PF00394 Cu-oxidase PF07731 Cu-oxidase_2

Amino Acid Sequences

MTCHGAFIVEDAHRPPFKYDEERVLLFADYYHKLDEQLAIGLKSVPFQWIGEPQSIAVNGNALGKCDLTSPFGCNTNCHHHRLVVKPGMTYRVRCVQFHQRKTQQSRAKKHGSKRDFWGRLETRWRPIRDQGAFVLHYEDDSTSTSIGPSVNTKPLDLSLTPFPNPKEFNKIVHLPNEGNTWLADTFEPLDPKEVAPTAAEVTRRIFIQGQQVKMADGRINWFVNGEKYVETQPKVPFLVRAYTTKIKPDYKAAARNNGFDKKLGAYPIKLNDVVEIVIVNQASSIGVSEVHPWHLHGQEFYVIAHGTGAFTKAKLAEAEAHQKRHIRRDTEVIFTSQRGASYKGTTVPPGTVTGWMVLRMKAQTPGAFLMHCHTQVRTMLLSPNSEWIPIRTDNLSSAACSYGHGCSLIGRDRKPPAITRRISQEIYVSAQKFTTHVPRKLALTPCLHPENQPNIKTSI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.27
2	0.29
3	0.29
4	0.35
5	0.41
6	0.44
7	0.46
8	0.49
9	0.49
10	0.47
11	0.43
12	0.37
13	0.29
14	0.25
15	0.21
16	0.18
17	0.19
18	0.2
19	0.19
20	0.19
21	0.21
22	0.21
23	0.17
24	0.19
25	0.19
26	0.17
27	0.18
28	0.19
29	0.17
30	0.17
31	0.16
32	0.13
33	0.12
34	0.13
35	0.15
36	0.19
37	0.22
38	0.23
39	0.23
40	0.22
41	0.24
42	0.24
43	0.21
44	0.15
45	0.13
46	0.11
47	0.17
48	0.17
49	0.15
50	0.16
51	0.15
52	0.15
53	0.16
54	0.17
55	0.15
56	0.17
57	0.18
58	0.2
59	0.27
60	0.27
61	0.27
62	0.32
63	0.38
64	0.41
65	0.43
66	0.42
67	0.41
68	0.47
69	0.5
70	0.54
71	0.5
72	0.48
73	0.45
74	0.45
75	0.48
76	0.45
77	0.41
78	0.36
79	0.38
80	0.39
81	0.37
82	0.41
83	0.45
84	0.52
85	0.58
86	0.64
87	0.63
88	0.71
89	0.78
90	0.82
91	0.8
92	0.8
93	0.82
94	0.81
95	0.83
96	0.8
97	0.82
98	0.83
99	0.8
100	0.75
101	0.75
102	0.77
103	0.71
104	0.65
105	0.67
106	0.59
107	0.58
108	0.62
109	0.57
110	0.55
111	0.57
112	0.59
113	0.52
114	0.56
115	0.59
116	0.51
117	0.5
118	0.43
119	0.4
120	0.37
121	0.33
122	0.29
123	0.2
124	0.17
125	0.15
126	0.13
127	0.09
128	0.1
129	0.1
130	0.09
131	0.09
132	0.09
133	0.09
134	0.09
135	0.08
136	0.11
137	0.13
138	0.18
139	0.18
140	0.19
141	0.18
142	0.19
143	0.21
144	0.18
145	0.18
146	0.18
147	0.2
148	0.21
149	0.24
150	0.24
151	0.26
152	0.28
153	0.27
154	0.3
155	0.3
156	0.32
157	0.34
158	0.39
159	0.37
160	0.37
161	0.38
162	0.3
163	0.29
164	0.28
165	0.23
166	0.18
167	0.15
168	0.13
169	0.1
170	0.1
171	0.08
172	0.07
173	0.09
174	0.1
175	0.11
176	0.1
177	0.12
178	0.12
179	0.12
180	0.13
181	0.11
182	0.1
183	0.09
184	0.1
185	0.09
186	0.1
187	0.11
188	0.1
189	0.11
190	0.12
191	0.12
192	0.12
193	0.12
194	0.12
195	0.22
196	0.25
197	0.24
198	0.25
199	0.25
200	0.24
201	0.24
202	0.23
203	0.14
204	0.1
205	0.11
206	0.13
207	0.13
208	0.12
209	0.13
210	0.12
211	0.12
212	0.12
213	0.11
214	0.08
215	0.1
216	0.13
217	0.15
218	0.15
219	0.19
220	0.19
221	0.2
222	0.21
223	0.19
224	0.18
225	0.17
226	0.2
227	0.17
228	0.18
229	0.22
230	0.26
231	0.27
232	0.29
233	0.33
234	0.32
235	0.31
236	0.34
237	0.36
238	0.36
239	0.44
240	0.42
241	0.47
242	0.45
243	0.47
244	0.48
245	0.45
246	0.4
247	0.32
248	0.31
249	0.23
250	0.24
251	0.23
252	0.19
253	0.17
254	0.19
255	0.22
256	0.23
257	0.21
258	0.19
259	0.17
260	0.16
261	0.14
262	0.1
263	0.08
264	0.05
265	0.06
266	0.06
267	0.05
268	0.04
269	0.04
270	0.04
271	0.04
272	0.04
273	0.03
274	0.04
275	0.05
276	0.08
277	0.09
278	0.1
279	0.11
280	0.11
281	0.14
282	0.16
283	0.16
284	0.13
285	0.13
286	0.14
287	0.14
288	0.13
289	0.12
290	0.09
291	0.09
292	0.09
293	0.07
294	0.06
295	0.06
296	0.08
297	0.07
298	0.07
299	0.08
300	0.08
301	0.1
302	0.09
303	0.11
304	0.13
305	0.16
306	0.27
307	0.3
308	0.32
309	0.34
310	0.39
311	0.41
312	0.47
313	0.51
314	0.45
315	0.43
316	0.51
317	0.51
318	0.51
319	0.49
320	0.42
321	0.37
322	0.33
323	0.32
324	0.24
325	0.22
326	0.17
327	0.19
328	0.19
329	0.2
330	0.21
331	0.23
332	0.23
333	0.24
334	0.23
335	0.21
336	0.2
337	0.19
338	0.18
339	0.16
340	0.15
341	0.15
342	0.14
343	0.16
344	0.16
345	0.14
346	0.16
347	0.16
348	0.17
349	0.19
350	0.21
351	0.19
352	0.21
353	0.22
354	0.21
355	0.2
356	0.19
357	0.18
358	0.19
359	0.2
360	0.18
361	0.16
362	0.19
363	0.2
364	0.23
365	0.21
366	0.19
367	0.23
368	0.24
369	0.26
370	0.23
371	0.26
372	0.23
373	0.24
374	0.23
375	0.19
376	0.22
377	0.21
378	0.23
379	0.2
380	0.21
381	0.21
382	0.24
383	0.23
384	0.18
385	0.18
386	0.17
387	0.15
388	0.15
389	0.15
390	0.12
391	0.13
392	0.13
393	0.11
394	0.12
395	0.17
396	0.24
397	0.28
398	0.29
399	0.35
400	0.4
401	0.46
402	0.49
403	0.53
404	0.55
405	0.59
406	0.61
407	0.59
408	0.63
409	0.63
410	0.6
411	0.53
412	0.47
413	0.39
414	0.41
415	0.43
416	0.35
417	0.29
418	0.29
419	0.28
420	0.25
421	0.27
422	0.33
423	0.36
424	0.4
425	0.45
426	0.47
427	0.51
428	0.58
429	0.59
430	0.55
431	0.51
432	0.49
433	0.51
434	0.53
435	0.5
436	0.46
437	0.49
438	0.52
439	0.55
440	0.55

A0A0C4ELF0

3D AlphaFold-predicted Structure Viewer