Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1R1PZN4

Protein Details
Accession A0A1R1PZN4   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-48HESWDRFLPKFKKRNVKRKKPMKVGKKQKDRALFPBasic
NLS Segment(s)
PositionSequence
20-44FLPKFKKRNVKRKKPMKVGKKQKDR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024166  rRNA_assembly_KRR1  
Amino Acid Sequences MIKNELAKDPKLKHESWDRFLPKFKKRNVKRKKPMKVGKKQKDRALFPPLPQPSKVDLQLQSGEYFLSSAEKKVAELNKKHKLQTENIAKKKLEREKDFVPPKELPTNTVSSGASGDNASGTKIPANFSKKRKADLDQIDSLAKKFKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.6
3 0.58
4 0.64
5 0.59
6 0.57
7 0.65
8 0.67
9 0.66
10 0.66
11 0.7
12 0.71
13 0.76
14 0.83
15 0.86
16 0.88
17 0.89
18 0.92
19 0.93
20 0.93
21 0.93
22 0.93
23 0.93
24 0.92
25 0.92
26 0.92
27 0.89
28 0.86
29 0.84
30 0.78
31 0.73
32 0.72
33 0.64
34 0.54
35 0.56
36 0.53
37 0.47
38 0.43
39 0.39
40 0.33
41 0.33
42 0.33
43 0.29
44 0.25
45 0.25
46 0.27
47 0.24
48 0.21
49 0.18
50 0.16
51 0.11
52 0.1
53 0.06
54 0.07
55 0.06
56 0.07
57 0.08
58 0.08
59 0.08
60 0.13
61 0.17
62 0.22
63 0.28
64 0.36
65 0.43
66 0.46
67 0.47
68 0.49
69 0.47
70 0.45
71 0.48
72 0.51
73 0.52
74 0.54
75 0.57
76 0.52
77 0.52
78 0.57
79 0.55
80 0.53
81 0.48
82 0.49
83 0.49
84 0.59
85 0.64
86 0.57
87 0.55
88 0.48
89 0.47
90 0.49
91 0.44
92 0.38
93 0.33
94 0.34
95 0.29
96 0.3
97 0.26
98 0.18
99 0.19
100 0.16
101 0.14
102 0.1
103 0.09
104 0.08
105 0.08
106 0.08
107 0.08
108 0.08
109 0.1
110 0.11
111 0.14
112 0.2
113 0.28
114 0.35
115 0.41
116 0.51
117 0.52
118 0.58
119 0.61
120 0.59
121 0.62
122 0.64
123 0.65
124 0.58
125 0.57
126 0.55
127 0.5
128 0.45