Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1R1PGZ5

Protein Details
Accession A0A1R1PGZ5    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
94-120AERRILPRPTRKSRQKQSRPRSRTLTAHydrophilic
NLS Segment(s)
PositionSequence
100-114PRPTRKSRQKQSRPR
Subcellular Location(s) nucl 15.5, mito_nucl 12.166, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
Amino Acid Sequences MVAHLSKANGVAATPTELLLAQSLTDLEKSVPDLKKDLRPIQISAAKEIEVGQGKKAIAVFVPVPLLKQTRRVQQRVTRELEKKFSDSNVVFIAERRILPRPTRKSRQKQSRPRSRTLTAVYEKILEDLVYPSEIVGKRTRVKVDGSRTTKCFLSSKDATNVGYKLDTFSTVYKQLTGKDVVFEFDQDQAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.11
4 0.11
5 0.11
6 0.1
7 0.09
8 0.06
9 0.06
10 0.07
11 0.07
12 0.07
13 0.08
14 0.07
15 0.08
16 0.11
17 0.19
18 0.21
19 0.22
20 0.27
21 0.31
22 0.38
23 0.45
24 0.47
25 0.47
26 0.47
27 0.47
28 0.5
29 0.51
30 0.44
31 0.4
32 0.35
33 0.28
34 0.25
35 0.24
36 0.2
37 0.21
38 0.2
39 0.18
40 0.2
41 0.2
42 0.2
43 0.2
44 0.16
45 0.1
46 0.12
47 0.11
48 0.09
49 0.11
50 0.09
51 0.1
52 0.12
53 0.15
54 0.13
55 0.21
56 0.25
57 0.32
58 0.4
59 0.43
60 0.49
61 0.53
62 0.62
63 0.61
64 0.62
65 0.61
66 0.58
67 0.58
68 0.56
69 0.5
70 0.43
71 0.36
72 0.31
73 0.29
74 0.24
75 0.23
76 0.18
77 0.17
78 0.15
79 0.14
80 0.16
81 0.11
82 0.11
83 0.11
84 0.14
85 0.15
86 0.21
87 0.3
88 0.37
89 0.45
90 0.55
91 0.64
92 0.71
93 0.79
94 0.85
95 0.87
96 0.88
97 0.9
98 0.92
99 0.88
100 0.84
101 0.8
102 0.71
103 0.67
104 0.59
105 0.56
106 0.48
107 0.43
108 0.37
109 0.31
110 0.29
111 0.23
112 0.19
113 0.11
114 0.09
115 0.08
116 0.08
117 0.07
118 0.07
119 0.06
120 0.12
121 0.12
122 0.14
123 0.17
124 0.22
125 0.26
126 0.31
127 0.34
128 0.3
129 0.35
130 0.41
131 0.46
132 0.51
133 0.52
134 0.53
135 0.53
136 0.53
137 0.49
138 0.44
139 0.39
140 0.31
141 0.34
142 0.33
143 0.36
144 0.39
145 0.4
146 0.38
147 0.38
148 0.36
149 0.29
150 0.26
151 0.21
152 0.18
153 0.16
154 0.16
155 0.15
156 0.17
157 0.2
158 0.23
159 0.23
160 0.24
161 0.25
162 0.26
163 0.28
164 0.3
165 0.26
166 0.26
167 0.26
168 0.25
169 0.24
170 0.24
171 0.21