Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4FBT5

Protein Details
Accession A0A0C4FBT5    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
86-112IPKNKASTSKPYDKNNKKTNENKWKETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 11, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MYQATKAAYMNAKDYEETALSQKYLEQAISSFKIVASFVPWKIAITKYSNNWNPYKERTHLRVLRNNQNPTKVKGESSSKFNNYKIPKNKASTSKPYDKNNKKTNENKWKETFKMARVLMEVKDTIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.2
4 0.19
5 0.19
6 0.17
7 0.16
8 0.15
9 0.15
10 0.15
11 0.15
12 0.13
13 0.11
14 0.1
15 0.15
16 0.16
17 0.16
18 0.14
19 0.13
20 0.14
21 0.13
22 0.12
23 0.12
24 0.14
25 0.13
26 0.15
27 0.15
28 0.15
29 0.17
30 0.18
31 0.17
32 0.19
33 0.22
34 0.23
35 0.32
36 0.37
37 0.39
38 0.4
39 0.4
40 0.39
41 0.4
42 0.42
43 0.37
44 0.38
45 0.38
46 0.44
47 0.48
48 0.5
49 0.53
50 0.55
51 0.6
52 0.62
53 0.64
54 0.57
55 0.59
56 0.55
57 0.51
58 0.5
59 0.41
60 0.34
61 0.32
62 0.37
63 0.32
64 0.35
65 0.38
66 0.38
67 0.4
68 0.4
69 0.44
70 0.42
71 0.49
72 0.52
73 0.53
74 0.55
75 0.57
76 0.63
77 0.64
78 0.66
79 0.66
80 0.66
81 0.68
82 0.68
83 0.72
84 0.77
85 0.78
86 0.81
87 0.8
88 0.8
89 0.79
90 0.81
91 0.83
92 0.84
93 0.81
94 0.79
95 0.78
96 0.78
97 0.71
98 0.72
99 0.67
100 0.6
101 0.61
102 0.54
103 0.48
104 0.44
105 0.44
106 0.35
107 0.33
108 0.29