Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1R1PZ35

Protein Details
Accession A0A1R1PZ35    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
86-109AASITNTNKKHKRDKAQSRRSIGLHydrophilic
NLS Segment(s)
PositionSequence
165-168KRKK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013950  Mis14/Nsl1  
Gene Ontology GO:0000776  C:kinetochore  
GO:0000070  P:mitotic sister chromatid segregation  
Pfam View protein in Pfam  
PF08641  Mis14  
Amino Acid Sequences MDQQSDIQPIRIDSLGDVAYLRREFDDLIDRCFETNSVIQESFSNEEDLQALKQILCSSLKEWSNRVWACVGPNLMVNGFPYDEAAASITNTNKKHKRDKAQSRRSIGLGGLGPLIASDDNDGYAVNSTPQIGYEDVEPLDKKLEAEVADLMAEANDVLLSVSRKRKKSPKQVEDALNSAIKRAKLDLDSLDRQKITHPANQRPSGSDASSSSRSSLLEPPFTLDSPQLQSHIKFSLGDKSTVQSNVVETAAKLDYLLKETPETFEKLQALNSNLQLITAHLRSDKCKDLDQILSKTQSQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.14
4 0.14
5 0.12
6 0.16
7 0.16
8 0.17
9 0.14
10 0.15
11 0.15
12 0.18
13 0.27
14 0.23
15 0.26
16 0.28
17 0.28
18 0.27
19 0.28
20 0.24
21 0.18
22 0.2
23 0.2
24 0.22
25 0.22
26 0.22
27 0.22
28 0.25
29 0.24
30 0.22
31 0.21
32 0.16
33 0.16
34 0.17
35 0.17
36 0.14
37 0.13
38 0.13
39 0.1
40 0.12
41 0.12
42 0.14
43 0.14
44 0.16
45 0.15
46 0.21
47 0.25
48 0.26
49 0.28
50 0.29
51 0.37
52 0.36
53 0.36
54 0.31
55 0.28
56 0.28
57 0.29
58 0.26
59 0.17
60 0.18
61 0.17
62 0.15
63 0.14
64 0.13
65 0.1
66 0.1
67 0.09
68 0.08
69 0.07
70 0.07
71 0.07
72 0.07
73 0.06
74 0.06
75 0.09
76 0.11
77 0.16
78 0.19
79 0.27
80 0.34
81 0.4
82 0.5
83 0.57
84 0.66
85 0.71
86 0.81
87 0.83
88 0.87
89 0.89
90 0.84
91 0.77
92 0.67
93 0.57
94 0.46
95 0.38
96 0.27
97 0.19
98 0.14
99 0.1
100 0.09
101 0.08
102 0.08
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.05
110 0.04
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.07
119 0.07
120 0.07
121 0.07
122 0.08
123 0.08
124 0.09
125 0.09
126 0.08
127 0.09
128 0.09
129 0.08
130 0.07
131 0.09
132 0.08
133 0.08
134 0.08
135 0.07
136 0.07
137 0.07
138 0.06
139 0.04
140 0.04
141 0.03
142 0.02
143 0.02
144 0.02
145 0.02
146 0.03
147 0.04
148 0.08
149 0.17
150 0.23
151 0.26
152 0.32
153 0.42
154 0.52
155 0.62
156 0.7
157 0.7
158 0.72
159 0.77
160 0.77
161 0.69
162 0.61
163 0.52
164 0.43
165 0.34
166 0.28
167 0.23
168 0.17
169 0.15
170 0.14
171 0.14
172 0.13
173 0.15
174 0.17
175 0.21
176 0.26
177 0.28
178 0.29
179 0.27
180 0.26
181 0.26
182 0.29
183 0.27
184 0.27
185 0.33
186 0.39
187 0.47
188 0.52
189 0.51
190 0.47
191 0.48
192 0.45
193 0.37
194 0.3
195 0.24
196 0.25
197 0.27
198 0.24
199 0.21
200 0.19
201 0.19
202 0.2
203 0.25
204 0.23
205 0.23
206 0.22
207 0.25
208 0.26
209 0.25
210 0.24
211 0.18
212 0.18
213 0.19
214 0.2
215 0.19
216 0.19
217 0.2
218 0.21
219 0.22
220 0.2
221 0.17
222 0.18
223 0.24
224 0.24
225 0.25
226 0.23
227 0.23
228 0.26
229 0.26
230 0.26
231 0.17
232 0.16
233 0.16
234 0.16
235 0.15
236 0.11
237 0.14
238 0.13
239 0.12
240 0.11
241 0.12
242 0.12
243 0.16
244 0.17
245 0.15
246 0.17
247 0.18
248 0.21
249 0.22
250 0.25
251 0.22
252 0.26
253 0.28
254 0.26
255 0.29
256 0.3
257 0.31
258 0.3
259 0.3
260 0.28
261 0.25
262 0.25
263 0.21
264 0.18
265 0.21
266 0.17
267 0.18
268 0.19
269 0.22
270 0.26
271 0.32
272 0.38
273 0.36
274 0.4
275 0.42
276 0.44
277 0.51
278 0.54
279 0.54
280 0.52
281 0.53