Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EP33

Protein Details
Accession A0A0C4EP33    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
71-90ALHHKPKRAKTPPPVNPPQTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, plas 9, mito 3, E.R. 2
Family & Domain DBs
Amino Acid Sequences MLRLSLVAIFLSLVALNAVYASQEEPHALAKRGSTWHASIRSGAAFMETTPAAMCPMRHSWWIALKDKCDALHHKPKRAKTPPPVNPPQTIVVTAPPPPTAYLVQPQPAVVYAQPAQVPAQAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.06
11 0.07
12 0.08
13 0.13
14 0.16
15 0.16
16 0.17
17 0.17
18 0.2
19 0.22
20 0.23
21 0.21
22 0.21
23 0.26
24 0.28
25 0.28
26 0.25
27 0.24
28 0.22
29 0.19
30 0.16
31 0.11
32 0.08
33 0.07
34 0.09
35 0.07
36 0.07
37 0.06
38 0.07
39 0.07
40 0.07
41 0.07
42 0.08
43 0.12
44 0.13
45 0.14
46 0.15
47 0.16
48 0.22
49 0.26
50 0.29
51 0.28
52 0.27
53 0.28
54 0.28
55 0.27
56 0.24
57 0.25
58 0.27
59 0.36
60 0.4
61 0.47
62 0.52
63 0.57
64 0.64
65 0.67
66 0.68
67 0.68
68 0.74
69 0.75
70 0.79
71 0.81
72 0.75
73 0.69
74 0.63
75 0.56
76 0.46
77 0.37
78 0.29
79 0.23
80 0.21
81 0.21
82 0.19
83 0.17
84 0.16
85 0.16
86 0.18
87 0.17
88 0.18
89 0.22
90 0.24
91 0.26
92 0.26
93 0.25
94 0.23
95 0.22
96 0.21
97 0.15
98 0.17
99 0.15
100 0.17
101 0.18
102 0.18
103 0.18