Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4FDA3

Protein Details
Accession A0A0C4FDA3    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-81EFFFKMMKVSQRKKKLKIKSMKSHydrophilic
NLS Segment(s)
PositionSequence
70-81RKKKLKIKSMKS
Subcellular Location(s) nucl 15, mito_nucl 11.833, cyto_nucl 9.333, mito 7.5
Family & Domain DBs
Amino Acid Sequences MSSNALPLTQIASPASRSDDAVDPELLKLTQELIEAHPKEEIEKHESEDEEEEENQQEEFFFKMMKVSQRKKKLKIKSMKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.18
3 0.16
4 0.16
5 0.18
6 0.2
7 0.21
8 0.22
9 0.22
10 0.18
11 0.18
12 0.18
13 0.15
14 0.11
15 0.08
16 0.07
17 0.07
18 0.07
19 0.08
20 0.09
21 0.17
22 0.17
23 0.18
24 0.17
25 0.16
26 0.17
27 0.18
28 0.19
29 0.16
30 0.16
31 0.18
32 0.19
33 0.19
34 0.2
35 0.19
36 0.18
37 0.15
38 0.14
39 0.14
40 0.12
41 0.13
42 0.11
43 0.1
44 0.08
45 0.07
46 0.08
47 0.07
48 0.07
49 0.06
50 0.09
51 0.13
52 0.22
53 0.31
54 0.4
55 0.5
56 0.61
57 0.7
58 0.78
59 0.84
60 0.86
61 0.87