Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3BCC0

Protein Details
Accession G3BCC0    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
91-113YRKLVFKVPKWTKKSFRENPMHHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, mito_nucl 13.833, nucl 9.5, cyto_nucl 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG cten:CANTEDRAFT_96236  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRASLTNHGGYLWKSAPRLSSPQKSRLRQRMKTVDANIEAIYQSLPKDHNGLTSYRKVDYLKFKFPKENEMSAKDKYTTFDKKAKDYRKLVFKVPKWTKKSFRENPMHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.21
4 0.2
5 0.2
6 0.22
7 0.24
8 0.26
9 0.34
10 0.37
11 0.44
12 0.47
13 0.56
14 0.64
15 0.68
16 0.74
17 0.76
18 0.78
19 0.75
20 0.79
21 0.79
22 0.76
23 0.75
24 0.68
25 0.63
26 0.54
27 0.49
28 0.39
29 0.29
30 0.23
31 0.16
32 0.13
33 0.08
34 0.07
35 0.07
36 0.07
37 0.07
38 0.1
39 0.1
40 0.13
41 0.13
42 0.16
43 0.18
44 0.21
45 0.22
46 0.2
47 0.22
48 0.2
49 0.24
50 0.32
51 0.34
52 0.39
53 0.42
54 0.44
55 0.49
56 0.49
57 0.54
58 0.49
59 0.51
60 0.45
61 0.46
62 0.47
63 0.43
64 0.44
65 0.36
66 0.31
67 0.26
68 0.29
69 0.31
70 0.33
71 0.38
72 0.39
73 0.46
74 0.55
75 0.62
76 0.64
77 0.64
78 0.66
79 0.7
80 0.7
81 0.7
82 0.71
83 0.67
84 0.69
85 0.73
86 0.75
87 0.72
88 0.78
89 0.79
90 0.79
91 0.84
92 0.83
93 0.83