Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3B660

Protein Details
Accession G3B660    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-37KAPARVTKKQINPKKASPRVYKPKKGDHydrophilic
NLS Segment(s)
PositionSequence
9-35KNKAPARVTKKQINPKKASPRVYKPKK
72-82RRQLEKANKKK
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG cten:CANTEDRAFT_106929  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGNLKLKNKAPARVTKKQINPKKASPRVYKPKKGDLTANLAKTHHSKLVVDTEKLVSSRVGHLELLKGSRRQLEKANKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.7
4 0.7
5 0.74
6 0.77
7 0.8
8 0.79
9 0.77
10 0.77
11 0.81
12 0.79
13 0.79
14 0.76
15 0.78
16 0.79
17 0.82
18 0.82
19 0.76
20 0.78
21 0.73
22 0.67
23 0.62
24 0.54
25 0.52
26 0.48
27 0.45
28 0.36
29 0.31
30 0.3
31 0.28
32 0.27
33 0.2
34 0.17
35 0.15
36 0.16
37 0.26
38 0.27
39 0.25
40 0.24
41 0.23
42 0.24
43 0.24
44 0.22
45 0.13
46 0.12
47 0.15
48 0.15
49 0.15
50 0.15
51 0.15
52 0.17
53 0.19
54 0.21
55 0.23
56 0.23
57 0.24
58 0.31
59 0.33
60 0.34
61 0.41
62 0.49