Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3B2A9

Protein Details
Accession G3B2A9   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-42REYVIPKKTKLPPRPKWLIKEEHydrophilic
114-147VVTERKVKLKQSKQKKSHRKYRKIEEGRAKEKEFBasic
NLS Segment(s)
PositionSequence
118-143RKVKLKQSKQKKSHRKYRKIEEGRAK
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
KEGG cten:CANTEDRAFT_120400  -  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MMGIRTSGLCRYLLRPQVPCREYVIPKKTKLPPRPKWLIKEEDIEESFIKGGSGPGGQKINKTNSKVQLKHIPTGIVVTSQHSRSQEQNRQKAREILAEKLDLMENGPKSRVAVVTERKVKLKQSKQKKSHRKYRKIEEGRAKEKEFEELVNIEDEIDQMTGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.44
3 0.5
4 0.59
5 0.57
6 0.55
7 0.52
8 0.52
9 0.53
10 0.56
11 0.59
12 0.55
13 0.57
14 0.64
15 0.67
16 0.7
17 0.74
18 0.75
19 0.74
20 0.77
21 0.85
22 0.83
23 0.81
24 0.79
25 0.75
26 0.67
27 0.63
28 0.56
29 0.51
30 0.45
31 0.39
32 0.32
33 0.25
34 0.22
35 0.16
36 0.13
37 0.08
38 0.07
39 0.06
40 0.08
41 0.07
42 0.1
43 0.15
44 0.15
45 0.18
46 0.23
47 0.3
48 0.34
49 0.37
50 0.4
51 0.45
52 0.54
53 0.53
54 0.53
55 0.55
56 0.52
57 0.51
58 0.45
59 0.37
60 0.28
61 0.27
62 0.22
63 0.13
64 0.11
65 0.1
66 0.11
67 0.12
68 0.14
69 0.14
70 0.16
71 0.21
72 0.29
73 0.36
74 0.43
75 0.51
76 0.55
77 0.58
78 0.58
79 0.56
80 0.49
81 0.48
82 0.42
83 0.35
84 0.31
85 0.28
86 0.26
87 0.22
88 0.2
89 0.12
90 0.11
91 0.12
92 0.11
93 0.12
94 0.13
95 0.12
96 0.12
97 0.14
98 0.14
99 0.13
100 0.19
101 0.25
102 0.33
103 0.4
104 0.42
105 0.44
106 0.45
107 0.5
108 0.53
109 0.57
110 0.58
111 0.62
112 0.71
113 0.78
114 0.87
115 0.91
116 0.91
117 0.91
118 0.93
119 0.92
120 0.91
121 0.92
122 0.92
123 0.9
124 0.9
125 0.9
126 0.88
127 0.86
128 0.83
129 0.74
130 0.68
131 0.59
132 0.55
133 0.45
134 0.36
135 0.31
136 0.25
137 0.24
138 0.2
139 0.19
140 0.14
141 0.13
142 0.12
143 0.1
144 0.09