Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8YE98

Protein Details
Accession G8YE98    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
102-123KPSMNKKSRKFRRNLDHHVKKHBasic
NLS Segment(s)
PositionSequence
106-114NKKSRKFRR
Subcellular Location(s) nucl 14.5, cyto_nucl 11.833, mito_nucl 10.166, cyto 7, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022554  RGI1  
IPR038235  RGI1_sf  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0006112  P:energy reserve metabolic process  
Pfam View protein in Pfam  
PF10843  RGI1  
Amino Acid Sequences MTNKANKKSKAVELDLDNCERLEHLKEVPKSRSSSITSIESDGSLQKSIKPPPMREFDDLKSFEAYLRDETWDNEFDYCHAHVMYYPPFIMKTVHNDFEKIKPSMNKKSRKFRRNLDHHVKKHLMAEMERCSGFKMDFDKVGLEDNPNMLKWIYEDTSNHGFDDDEAQRFHRQWKVHLEVSCNNENPMVEVDYQAIPILD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.56
3 0.52
4 0.43
5 0.35
6 0.3
7 0.25
8 0.21
9 0.19
10 0.17
11 0.21
12 0.28
13 0.34
14 0.41
15 0.46
16 0.49
17 0.48
18 0.48
19 0.49
20 0.45
21 0.43
22 0.4
23 0.39
24 0.35
25 0.33
26 0.31
27 0.25
28 0.21
29 0.2
30 0.17
31 0.15
32 0.14
33 0.16
34 0.21
35 0.25
36 0.33
37 0.37
38 0.4
39 0.45
40 0.52
41 0.53
42 0.52
43 0.53
44 0.47
45 0.49
46 0.46
47 0.4
48 0.34
49 0.29
50 0.26
51 0.23
52 0.21
53 0.15
54 0.15
55 0.15
56 0.15
57 0.16
58 0.18
59 0.17
60 0.17
61 0.14
62 0.13
63 0.12
64 0.14
65 0.13
66 0.11
67 0.09
68 0.08
69 0.09
70 0.12
71 0.13
72 0.11
73 0.11
74 0.1
75 0.11
76 0.11
77 0.12
78 0.1
79 0.16
80 0.18
81 0.23
82 0.23
83 0.24
84 0.25
85 0.28
86 0.31
87 0.24
88 0.23
89 0.24
90 0.3
91 0.39
92 0.46
93 0.52
94 0.55
95 0.66
96 0.73
97 0.77
98 0.78
99 0.77
100 0.79
101 0.8
102 0.82
103 0.83
104 0.83
105 0.76
106 0.78
107 0.7
108 0.6
109 0.52
110 0.45
111 0.36
112 0.27
113 0.29
114 0.25
115 0.26
116 0.25
117 0.22
118 0.2
119 0.19
120 0.17
121 0.15
122 0.15
123 0.15
124 0.16
125 0.16
126 0.16
127 0.15
128 0.18
129 0.16
130 0.14
131 0.13
132 0.14
133 0.15
134 0.14
135 0.15
136 0.12
137 0.11
138 0.1
139 0.14
140 0.13
141 0.14
142 0.15
143 0.2
144 0.26
145 0.27
146 0.26
147 0.22
148 0.21
149 0.19
150 0.25
151 0.22
152 0.19
153 0.19
154 0.22
155 0.25
156 0.26
157 0.32
158 0.31
159 0.3
160 0.34
161 0.43
162 0.47
163 0.5
164 0.51
165 0.52
166 0.52
167 0.56
168 0.56
169 0.47
170 0.41
171 0.37
172 0.34
173 0.3
174 0.26
175 0.23
176 0.16
177 0.16
178 0.18
179 0.17
180 0.17