Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YCP9

Protein Details
Accession G8YCP9    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
157-182NEDASLRKGKRKKKSQNYPDDIKRIHBasic
NLS Segment(s)
PositionSequence
163-170RKGKRKKK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.833, cyto 5, cyto_mito 4.499, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013942  Mediator_Med19_fun  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF08633  Rox3  
Amino Acid Sequences MFYYNLNSLYMGLNYNAIFFMGADSYLIDTEKKYKLVDPSPLENLIALYGLEDVTKSLSRINPDGSKGVKLRKSYKNHIQDISGKHQIPPPKPIPMSLLDPGLSQMPDTIQQLSPDLLHKALKFEKTPANGIPGFNIVDLAMNDQHTLMRGDDAVDNEDASLRKGKRKKKSQNYPDDIKRIHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.1
5 0.09
6 0.08
7 0.08
8 0.06
9 0.06
10 0.06
11 0.06
12 0.07
13 0.07
14 0.08
15 0.07
16 0.08
17 0.14
18 0.16
19 0.18
20 0.18
21 0.22
22 0.29
23 0.33
24 0.41
25 0.4
26 0.42
27 0.44
28 0.43
29 0.4
30 0.32
31 0.27
32 0.19
33 0.14
34 0.09
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.06
42 0.07
43 0.07
44 0.1
45 0.12
46 0.15
47 0.17
48 0.22
49 0.22
50 0.24
51 0.27
52 0.25
53 0.27
54 0.27
55 0.32
56 0.32
57 0.34
58 0.41
59 0.46
60 0.52
61 0.56
62 0.63
63 0.66
64 0.66
65 0.62
66 0.56
67 0.53
68 0.51
69 0.49
70 0.45
71 0.36
72 0.32
73 0.34
74 0.37
75 0.33
76 0.35
77 0.31
78 0.3
79 0.3
80 0.3
81 0.3
82 0.27
83 0.28
84 0.22
85 0.21
86 0.16
87 0.16
88 0.15
89 0.13
90 0.11
91 0.07
92 0.06
93 0.06
94 0.07
95 0.08
96 0.1
97 0.09
98 0.1
99 0.11
100 0.11
101 0.11
102 0.11
103 0.11
104 0.11
105 0.12
106 0.12
107 0.16
108 0.19
109 0.22
110 0.21
111 0.24
112 0.29
113 0.29
114 0.32
115 0.29
116 0.31
117 0.29
118 0.28
119 0.25
120 0.21
121 0.19
122 0.15
123 0.15
124 0.09
125 0.09
126 0.09
127 0.1
128 0.1
129 0.1
130 0.1
131 0.1
132 0.1
133 0.1
134 0.11
135 0.09
136 0.09
137 0.09
138 0.1
139 0.12
140 0.13
141 0.15
142 0.13
143 0.13
144 0.12
145 0.14
146 0.13
147 0.13
148 0.2
149 0.2
150 0.29
151 0.37
152 0.47
153 0.55
154 0.66
155 0.76
156 0.79
157 0.88
158 0.9
159 0.94
160 0.93
161 0.92
162 0.9
163 0.87