Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3BEG9

Protein Details
Accession G3BEG9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-30MQIPGKVKVKIRRIKHRHVGTHGGRRKBasic
NLS Segment(s)
PositionSequence
9-31KVKVKIRRIKHRHVGTHGGRRKG
Subcellular Location(s) mito_nucl 8.666, nucl 8.5, mito 8.5, cyto_nucl 7.833, cyto_mito 7.833
Family & Domain DBs
KEGG cten:CANTEDRAFT_137022  -  
Amino Acid Sequences MILMQIPGKVKVKIRRIKHRHVGTHGGRRKGPPSYDDVLESKKLEIQSFETQSLTSAYDFQDKQTLNSIIDDKDEDFDLLPKFQDIIDESTEGTPHECDRGESLKVTDTGNDSLKDTGVSESVKSLIPTAASEVQPPSQVPSLHFSRPRFKSDVGKHQPHSMSTKHRAVMRNQKLVMLQHHQLRMVKLVVLIYMVYLLMGHLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.76
4 0.82
5 0.85
6 0.86
7 0.84
8 0.82
9 0.82
10 0.8
11 0.82
12 0.78
13 0.73
14 0.67
15 0.63
16 0.6
17 0.57
18 0.51
19 0.43
20 0.43
21 0.41
22 0.39
23 0.39
24 0.37
25 0.33
26 0.33
27 0.31
28 0.24
29 0.23
30 0.23
31 0.21
32 0.2
33 0.22
34 0.27
35 0.29
36 0.29
37 0.26
38 0.25
39 0.25
40 0.24
41 0.19
42 0.12
43 0.1
44 0.11
45 0.16
46 0.16
47 0.16
48 0.21
49 0.2
50 0.21
51 0.26
52 0.26
53 0.21
54 0.23
55 0.24
56 0.18
57 0.18
58 0.18
59 0.13
60 0.12
61 0.12
62 0.1
63 0.08
64 0.11
65 0.11
66 0.1
67 0.09
68 0.09
69 0.09
70 0.08
71 0.09
72 0.08
73 0.1
74 0.11
75 0.11
76 0.12
77 0.11
78 0.12
79 0.1
80 0.09
81 0.07
82 0.06
83 0.07
84 0.07
85 0.07
86 0.1
87 0.12
88 0.12
89 0.12
90 0.13
91 0.13
92 0.14
93 0.13
94 0.12
95 0.11
96 0.13
97 0.14
98 0.14
99 0.13
100 0.13
101 0.13
102 0.12
103 0.1
104 0.08
105 0.08
106 0.08
107 0.07
108 0.08
109 0.09
110 0.09
111 0.09
112 0.09
113 0.08
114 0.08
115 0.08
116 0.1
117 0.13
118 0.12
119 0.14
120 0.14
121 0.15
122 0.15
123 0.15
124 0.15
125 0.15
126 0.16
127 0.16
128 0.2
129 0.23
130 0.28
131 0.34
132 0.35
133 0.41
134 0.44
135 0.48
136 0.47
137 0.46
138 0.5
139 0.53
140 0.61
141 0.6
142 0.64
143 0.61
144 0.64
145 0.62
146 0.55
147 0.52
148 0.46
149 0.46
150 0.46
151 0.5
152 0.46
153 0.5
154 0.52
155 0.56
156 0.62
157 0.62
158 0.63
159 0.57
160 0.56
161 0.53
162 0.53
163 0.5
164 0.44
165 0.4
166 0.38
167 0.4
168 0.41
169 0.41
170 0.39
171 0.37
172 0.32
173 0.28
174 0.23
175 0.21
176 0.17
177 0.15
178 0.13
179 0.09
180 0.08
181 0.07
182 0.05
183 0.05