Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YIQ5

Protein Details
Accession G8YIQ5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSKEKRDKKQRKKRSEEIVTGDQBasic
NLS Segment(s)
PositionSequence
4-14EKRDKKQRKKR
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSKEKRDKKQRKKRSEEIVTGDQWGDIFIPYEKGDQLDYLLTYKLETNTVTTSSDRSKQGHNYDHEVIPRSCNLSNTNVLEDKDLSDIVASIVDICDSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.87
4 0.83
5 0.78
6 0.67
7 0.59
8 0.49
9 0.38
10 0.28
11 0.21
12 0.13
13 0.07
14 0.07
15 0.06
16 0.08
17 0.09
18 0.1
19 0.1
20 0.1
21 0.1
22 0.09
23 0.1
24 0.08
25 0.08
26 0.08
27 0.08
28 0.07
29 0.08
30 0.08
31 0.08
32 0.08
33 0.08
34 0.09
35 0.09
36 0.1
37 0.11
38 0.11
39 0.12
40 0.14
41 0.18
42 0.19
43 0.2
44 0.23
45 0.28
46 0.34
47 0.39
48 0.4
49 0.42
50 0.42
51 0.43
52 0.41
53 0.39
54 0.33
55 0.28
56 0.26
57 0.24
58 0.21
59 0.22
60 0.22
61 0.22
62 0.27
63 0.27
64 0.3
65 0.29
66 0.28
67 0.28
68 0.26
69 0.23
70 0.19
71 0.17
72 0.13
73 0.1
74 0.1
75 0.08
76 0.08
77 0.06
78 0.05
79 0.06