Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8Y1X9

Protein Details
Accession G8Y1X9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
46-74RTEHLSKKARSRTRRSHKTQPPARRCAKLBasic
NLS Segment(s)
PositionSequence
52-64KKARSRTRRSHKT
Subcellular Location(s) nucl 18.5, cyto_nucl 12, mito 6
Family & Domain DBs
Amino Acid Sequences MSAGDRVSLSTHSSVFARMDHIKTISRRAANRPPAASHSTPGNFQRTEHLSKKARSRTRRSHKTQPPARRCAKLACQQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.17
5 0.19
6 0.2
7 0.21
8 0.22
9 0.26
10 0.27
11 0.32
12 0.33
13 0.34
14 0.36
15 0.41
16 0.49
17 0.52
18 0.54
19 0.5
20 0.46
21 0.45
22 0.47
23 0.4
24 0.32
25 0.28
26 0.24
27 0.25
28 0.25
29 0.25
30 0.2
31 0.2
32 0.24
33 0.24
34 0.3
35 0.31
36 0.38
37 0.39
38 0.44
39 0.53
40 0.57
41 0.62
42 0.64
43 0.71
44 0.74
45 0.79
46 0.85
47 0.85
48 0.86
49 0.87
50 0.89
51 0.89
52 0.89
53 0.87
54 0.86
55 0.85
56 0.8
57 0.73
58 0.71
59 0.71