Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3B9C3

Protein Details
Accession G3B9C3    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
95-114TSGSVSKGSHKPKPFKRRGVHydrophilic
NLS Segment(s)
PositionSequence
101-114KGSHKPKPFKRRGV
Subcellular Location(s) nucl 9.5, mito 9, cyto_nucl 9, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005634  C:nucleus  
GO:0120114  C:Sm-like protein family complex  
GO:0006396  P:RNA processing  
KEGG cten:CANTEDRAFT_109388  -  
Pfam View protein in Pfam  
PF01423  LSM  
Amino Acid Sequences MKLVSFLMHLPGSTSHPVTVELKNGNSVNGQVLSCSPTMNLALKNIKLIQPHQDAQFLNYMNIRGNQIRQVLLPEDLNLDAVLAKCVQNTKSKGTSGSVSKGSHKPKPFKRRGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.17
3 0.18
4 0.21
5 0.23
6 0.22
7 0.23
8 0.22
9 0.22
10 0.26
11 0.26
12 0.24
13 0.21
14 0.2
15 0.17
16 0.16
17 0.15
18 0.11
19 0.11
20 0.12
21 0.12
22 0.11
23 0.09
24 0.08
25 0.1
26 0.12
27 0.12
28 0.14
29 0.16
30 0.16
31 0.18
32 0.18
33 0.19
34 0.19
35 0.19
36 0.22
37 0.24
38 0.26
39 0.25
40 0.28
41 0.26
42 0.25
43 0.27
44 0.21
45 0.17
46 0.15
47 0.14
48 0.11
49 0.12
50 0.13
51 0.11
52 0.12
53 0.15
54 0.16
55 0.16
56 0.15
57 0.16
58 0.15
59 0.15
60 0.15
61 0.11
62 0.11
63 0.1
64 0.11
65 0.08
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.08
73 0.11
74 0.13
75 0.2
76 0.24
77 0.29
78 0.33
79 0.34
80 0.35
81 0.35
82 0.39
83 0.35
84 0.37
85 0.36
86 0.34
87 0.39
88 0.44
89 0.49
90 0.52
91 0.57
92 0.62
93 0.67
94 0.77