Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8YG17

Protein Details
Accession G8YG17    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
65-89AEIARIRKARQEKRRRLEEKAKELGBasic
NLS Segment(s)
PositionSequence
69-84RIRKARQEKRRRLEEK
Subcellular Location(s) mito 13.5, cyto_mito 9.5, nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MYRRFFGGLSRTQLETAKFGLYLLTPICVMYYVGLDTDRKFNLPGFWPDPATLNQVPKEPYEIQAEIARIRKARQEKRRRLEEKAKELGIQVEEDGEEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.24
4 0.19
5 0.16
6 0.15
7 0.14
8 0.11
9 0.12
10 0.1
11 0.09
12 0.08
13 0.08
14 0.08
15 0.07
16 0.07
17 0.06
18 0.06
19 0.05
20 0.06
21 0.07
22 0.08
23 0.08
24 0.12
25 0.12
26 0.12
27 0.12
28 0.13
29 0.14
30 0.17
31 0.21
32 0.19
33 0.2
34 0.2
35 0.2
36 0.21
37 0.19
38 0.21
39 0.18
40 0.19
41 0.18
42 0.2
43 0.21
44 0.19
45 0.23
46 0.19
47 0.19
48 0.21
49 0.21
50 0.2
51 0.22
52 0.22
53 0.2
54 0.23
55 0.23
56 0.19
57 0.2
58 0.26
59 0.34
60 0.43
61 0.51
62 0.6
63 0.68
64 0.77
65 0.87
66 0.84
67 0.84
68 0.84
69 0.84
70 0.82
71 0.78
72 0.7
73 0.6
74 0.56
75 0.5
76 0.4
77 0.31
78 0.22
79 0.15