Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3B8S6

Protein Details
Accession G3B8S6    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
77-116PKDLRAKKTRAIRRKLTKFEATRITDKARKQKTTFPKRSFHydrophilic
NLS Segment(s)
PositionSequence
77-114PKDLRAKKTRAIRRKLTKFEATRITDKARKQKTTFPKR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG cten:CANTEDRAFT_95315  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAGLKAYELRTKSKEQLENQLVELKQELANLKVQKLQKPSLPRIHTVRKNIARVLTIINLNQRENVRAFYQGKKYLPKDLRAKKTRAIRRKLTKFEATRITDKARKQKTTFPKRSFAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.52
3 0.6
4 0.59
5 0.57
6 0.52
7 0.52
8 0.42
9 0.36
10 0.32
11 0.23
12 0.18
13 0.19
14 0.18
15 0.13
16 0.2
17 0.2
18 0.21
19 0.24
20 0.27
21 0.3
22 0.34
23 0.36
24 0.35
25 0.41
26 0.48
27 0.51
28 0.51
29 0.5
30 0.52
31 0.59
32 0.6
33 0.58
34 0.6
35 0.56
36 0.56
37 0.54
38 0.48
39 0.39
40 0.34
41 0.3
42 0.22
43 0.17
44 0.15
45 0.17
46 0.17
47 0.16
48 0.18
49 0.16
50 0.16
51 0.16
52 0.17
53 0.14
54 0.18
55 0.21
56 0.23
57 0.28
58 0.32
59 0.34
60 0.39
61 0.4
62 0.44
63 0.45
64 0.49
65 0.53
66 0.58
67 0.65
68 0.65
69 0.67
70 0.64
71 0.7
72 0.72
73 0.72
74 0.71
75 0.71
76 0.75
77 0.81
78 0.83
79 0.8
80 0.79
81 0.73
82 0.72
83 0.7
84 0.65
85 0.59
86 0.55
87 0.56
88 0.52
89 0.55
90 0.59
91 0.59
92 0.62
93 0.62
94 0.67
95 0.71
96 0.77
97 0.81
98 0.77
99 0.76
100 0.71