Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YAP0

Protein Details
Accession G8YAP0   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
157-181SWPLAKSQGRIERRKRVQMWLRNEFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences MIRGVRRLSSKSVPYETQPRSKYNVRSSAFNIKPVPTQGLVFNPPASMPSAKNTPRAFLPPSDPRVERLREFQRSYTPEEVATMPLIYGIKAEKEYNVTPDVVAEVRRLREEDPAQWTVNKLAKKFGISRMVANVITQESRVRQSQISEELAELKKSWPLAKSQGRIERRKRVQMWLRNEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.57
3 0.56
4 0.57
5 0.55
6 0.52
7 0.53
8 0.58
9 0.62
10 0.61
11 0.64
12 0.57
13 0.58
14 0.6
15 0.64
16 0.58
17 0.55
18 0.48
19 0.4
20 0.41
21 0.38
22 0.36
23 0.26
24 0.26
25 0.22
26 0.24
27 0.25
28 0.23
29 0.21
30 0.18
31 0.17
32 0.16
33 0.17
34 0.14
35 0.13
36 0.15
37 0.23
38 0.25
39 0.33
40 0.32
41 0.32
42 0.32
43 0.35
44 0.33
45 0.28
46 0.32
47 0.32
48 0.35
49 0.38
50 0.36
51 0.35
52 0.39
53 0.4
54 0.35
55 0.36
56 0.4
57 0.42
58 0.44
59 0.42
60 0.44
61 0.43
62 0.47
63 0.41
64 0.34
65 0.27
66 0.26
67 0.25
68 0.18
69 0.16
70 0.1
71 0.07
72 0.07
73 0.07
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.07
80 0.07
81 0.1
82 0.11
83 0.12
84 0.13
85 0.13
86 0.12
87 0.11
88 0.12
89 0.09
90 0.09
91 0.09
92 0.1
93 0.11
94 0.12
95 0.13
96 0.13
97 0.18
98 0.2
99 0.22
100 0.25
101 0.27
102 0.27
103 0.27
104 0.27
105 0.25
106 0.28
107 0.26
108 0.21
109 0.23
110 0.24
111 0.27
112 0.29
113 0.31
114 0.35
115 0.33
116 0.34
117 0.33
118 0.34
119 0.31
120 0.27
121 0.22
122 0.16
123 0.15
124 0.14
125 0.13
126 0.12
127 0.16
128 0.18
129 0.19
130 0.19
131 0.21
132 0.25
133 0.28
134 0.28
135 0.25
136 0.24
137 0.28
138 0.28
139 0.26
140 0.22
141 0.18
142 0.18
143 0.2
144 0.22
145 0.18
146 0.22
147 0.31
148 0.39
149 0.44
150 0.5
151 0.58
152 0.64
153 0.72
154 0.76
155 0.77
156 0.77
157 0.82
158 0.77
159 0.78
160 0.8
161 0.79