Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8Y1X4

Protein Details
Accession G8Y1X4   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
94-114RLRTRNGRKILARRRAKGRWYBasic
NLS Segment(s)
PositionSequence
84-112KRKRTFGFLARLRTRNGRKILARRRAKGR
Subcellular Location(s) mito 20.5, mito_nucl 12.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFWNVGIRIGRGLPTAMGGGSRQISFLSRPVVNNNIRSIEQGLMNKATITDTGIFNFLRVSPLFGAMQKRFKSLGNSYQPSTIKRKRTFGFLARLRTRNGRKILARRRAKGRWYLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.09
5 0.08
6 0.1
7 0.11
8 0.11
9 0.1
10 0.1
11 0.12
12 0.12
13 0.15
14 0.17
15 0.17
16 0.19
17 0.22
18 0.3
19 0.32
20 0.33
21 0.33
22 0.31
23 0.29
24 0.29
25 0.27
26 0.21
27 0.2
28 0.19
29 0.18
30 0.16
31 0.16
32 0.14
33 0.13
34 0.12
35 0.08
36 0.09
37 0.08
38 0.08
39 0.08
40 0.1
41 0.1
42 0.09
43 0.09
44 0.08
45 0.08
46 0.08
47 0.09
48 0.08
49 0.09
50 0.1
51 0.12
52 0.17
53 0.18
54 0.25
55 0.24
56 0.25
57 0.25
58 0.26
59 0.3
60 0.29
61 0.36
62 0.38
63 0.41
64 0.4
65 0.45
66 0.45
67 0.43
68 0.48
69 0.46
70 0.47
71 0.49
72 0.56
73 0.52
74 0.58
75 0.61
76 0.58
77 0.61
78 0.57
79 0.62
80 0.62
81 0.63
82 0.59
83 0.62
84 0.62
85 0.6
86 0.6
87 0.58
88 0.6
89 0.68
90 0.75
91 0.76
92 0.78
93 0.78
94 0.81
95 0.81
96 0.8
97 0.79