Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1R1XW94

Protein Details
Accession A0A1R1XW94    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
176-201EIEQPESKKTNKRRKAKKGVRTAITNHydrophilic
NLS Segment(s)
PositionSequence
183-195KKTNKRRKAKKGV
Subcellular Location(s) nucl 24, mito 1, cyto 1, golg 1, cyto_mito 1
Family & Domain DBs
Amino Acid Sequences MALLGNENFALADKIHVLPKWPIRGINDTSDISDADLNDSELESVIRSSSDKMHTNGFFVACFINLLTNDKVPVFKTVSNSLRKQYIETQRDNKNDLGKDGENDLDKDTKELNSNTVKIQPQLISPQESVIKPITSSLDDNADIDNKPIQNSKRHPKRSLADNILDRNKLANEKVEIEQPESKKTNKRRKAKKGVRTAITN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.16
4 0.19
5 0.25
6 0.32
7 0.38
8 0.37
9 0.39
10 0.4
11 0.47
12 0.47
13 0.45
14 0.43
15 0.36
16 0.35
17 0.32
18 0.28
19 0.22
20 0.2
21 0.15
22 0.12
23 0.12
24 0.11
25 0.1
26 0.1
27 0.09
28 0.08
29 0.08
30 0.06
31 0.06
32 0.06
33 0.06
34 0.07
35 0.08
36 0.12
37 0.17
38 0.21
39 0.22
40 0.28
41 0.28
42 0.29
43 0.29
44 0.25
45 0.2
46 0.17
47 0.16
48 0.09
49 0.09
50 0.07
51 0.07
52 0.07
53 0.11
54 0.11
55 0.11
56 0.12
57 0.12
58 0.13
59 0.12
60 0.15
61 0.14
62 0.15
63 0.18
64 0.25
65 0.31
66 0.36
67 0.37
68 0.36
69 0.38
70 0.36
71 0.36
72 0.37
73 0.41
74 0.41
75 0.44
76 0.49
77 0.51
78 0.53
79 0.53
80 0.47
81 0.42
82 0.37
83 0.32
84 0.3
85 0.23
86 0.21
87 0.2
88 0.19
89 0.14
90 0.14
91 0.14
92 0.12
93 0.11
94 0.12
95 0.12
96 0.11
97 0.14
98 0.13
99 0.17
100 0.18
101 0.19
102 0.19
103 0.23
104 0.23
105 0.21
106 0.23
107 0.19
108 0.17
109 0.21
110 0.22
111 0.2
112 0.19
113 0.2
114 0.21
115 0.2
116 0.22
117 0.19
118 0.17
119 0.14
120 0.15
121 0.15
122 0.13
123 0.14
124 0.13
125 0.14
126 0.14
127 0.15
128 0.14
129 0.14
130 0.12
131 0.13
132 0.15
133 0.13
134 0.14
135 0.19
136 0.22
137 0.3
138 0.38
139 0.48
140 0.56
141 0.64
142 0.67
143 0.7
144 0.73
145 0.74
146 0.75
147 0.7
148 0.67
149 0.64
150 0.68
151 0.64
152 0.57
153 0.48
154 0.4
155 0.36
156 0.32
157 0.28
158 0.26
159 0.24
160 0.27
161 0.29
162 0.32
163 0.32
164 0.33
165 0.38
166 0.35
167 0.4
168 0.39
169 0.43
170 0.47
171 0.56
172 0.63
173 0.66
174 0.75
175 0.78
176 0.86
177 0.92
178 0.93
179 0.92
180 0.93
181 0.92