Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YAG3

Protein Details
Accession G8YAG3   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MRSLPPPRITRKRRWRRIKRAIKAFFTKGHydrophilic
NLS Segment(s)
PositionSequence
7-23PRITRKRRWRRIKRAIK
Subcellular Location(s) mito 13, mito_nucl 12.333, nucl 9.5, cyto_nucl 7.666
Family & Domain DBs
Amino Acid Sequences MRSLPPPRITRKRRWRRIKRAIKAFFTKGYISDPGAFLSSSKGSKGSISTIRKSRFSPRYRKARLANPDMTLREGANVGIATASLVSKVASRASMPLLRPLRDRSNRMNFTVRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.93
4 0.96
5 0.96
6 0.95
7 0.95
8 0.92
9 0.88
10 0.84
11 0.76
12 0.68
13 0.59
14 0.5
15 0.4
16 0.35
17 0.29
18 0.24
19 0.21
20 0.18
21 0.16
22 0.16
23 0.15
24 0.11
25 0.12
26 0.12
27 0.11
28 0.11
29 0.11
30 0.11
31 0.12
32 0.13
33 0.14
34 0.21
35 0.25
36 0.29
37 0.35
38 0.38
39 0.39
40 0.4
41 0.45
42 0.47
43 0.5
44 0.56
45 0.57
46 0.65
47 0.68
48 0.73
49 0.69
50 0.68
51 0.68
52 0.65
53 0.6
54 0.51
55 0.5
56 0.44
57 0.4
58 0.32
59 0.24
60 0.17
61 0.14
62 0.12
63 0.09
64 0.08
65 0.06
66 0.05
67 0.05
68 0.04
69 0.04
70 0.04
71 0.03
72 0.04
73 0.04
74 0.05
75 0.06
76 0.07
77 0.08
78 0.09
79 0.11
80 0.15
81 0.2
82 0.2
83 0.28
84 0.32
85 0.34
86 0.37
87 0.42
88 0.48
89 0.52
90 0.57
91 0.58
92 0.64
93 0.66
94 0.68