Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1R1X0P9

Protein Details
Accession A0A1R1X0P9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
95-117TNDSHRKKRSRISEKPKKNEYFEBasic
NLS Segment(s)
PositionSequence
100-112RKKRSRISEKPKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006941  RNase_CAF1  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF04857  CAF1  
Amino Acid Sequences MDVTKANFQKVKLDFEKSINDSELISIDLEMTGLWDSFYSKANSIDNMQMKYEKIKNAAEKFQIIQFGVCTFHKKIVQDYYGSASDNSNNSEDSTNDSHRKKRSRISEKPKKNEYFEARPLNFYVYPSNKIGIFRKERVFSILNTAFEFLAENSFDFNKWVYQGKKYYRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.52
4 0.46
5 0.46
6 0.38
7 0.34
8 0.27
9 0.25
10 0.21
11 0.15
12 0.12
13 0.09
14 0.08
15 0.07
16 0.06
17 0.05
18 0.06
19 0.05
20 0.05
21 0.05
22 0.05
23 0.06
24 0.08
25 0.11
26 0.12
27 0.13
28 0.15
29 0.16
30 0.18
31 0.19
32 0.25
33 0.26
34 0.26
35 0.25
36 0.25
37 0.24
38 0.28
39 0.3
40 0.26
41 0.25
42 0.29
43 0.35
44 0.38
45 0.42
46 0.38
47 0.36
48 0.34
49 0.32
50 0.29
51 0.22
52 0.18
53 0.13
54 0.12
55 0.12
56 0.12
57 0.14
58 0.13
59 0.16
60 0.19
61 0.19
62 0.22
63 0.24
64 0.25
65 0.22
66 0.22
67 0.22
68 0.2
69 0.2
70 0.17
71 0.12
72 0.13
73 0.13
74 0.13
75 0.1
76 0.1
77 0.11
78 0.11
79 0.11
80 0.13
81 0.16
82 0.19
83 0.25
84 0.28
85 0.33
86 0.4
87 0.47
88 0.48
89 0.52
90 0.59
91 0.63
92 0.71
93 0.76
94 0.8
95 0.83
96 0.87
97 0.88
98 0.82
99 0.76
100 0.74
101 0.7
102 0.67
103 0.65
104 0.66
105 0.57
106 0.54
107 0.5
108 0.45
109 0.38
110 0.31
111 0.31
112 0.25
113 0.27
114 0.27
115 0.28
116 0.25
117 0.28
118 0.32
119 0.33
120 0.37
121 0.39
122 0.44
123 0.45
124 0.45
125 0.47
126 0.44
127 0.35
128 0.38
129 0.36
130 0.31
131 0.3
132 0.3
133 0.24
134 0.22
135 0.22
136 0.13
137 0.11
138 0.11
139 0.1
140 0.11
141 0.12
142 0.13
143 0.13
144 0.13
145 0.13
146 0.15
147 0.23
148 0.24
149 0.31
150 0.4