Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8YTW9

Protein Details
Accession G8YTW9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
18-37SKPLLKFKPKVVTRKTQDERHydrophilic
NLS Segment(s)
PositionSequence
53-71KPSQRGRGSMRGARGGRGR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007811  RPC4  
Gene Ontology GO:0005666  C:RNA polymerase III complex  
GO:0003677  F:DNA binding  
GO:0006383  P:transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF05132  RNA_pol_Rpc4  
Amino Acid Sequences MSNRLDSLNSKKPGTNASKPLLKFKPKVVTRKTQDERAKDAPTQVKEENVDRKPSQRGRGSMRGARGGRGRGNYAGTRLVSSGPLTEGSVSLGMNSTRNTIKREPGTSSSSPTPDFLQNLKVKREESVAKANSDESDSEDDGTKINMNRDYNFEEENVLFPIRPVRENDTSNEESGAESKETSPALVESRSATPMEKSQSPVKEEHIEDQLNKIKEYKAELETKITDSGDKLRKEESEKIESDFKQIVNQINNEFSEISLDETESGTSKDYMVIHLPSILPEFKRSSIVKDEDVKDENMKDEEVSVENLKEEDVKMIDEEPTRTKLAADIPNLRGRIGSLNIHKSGKISINLGNDNNLVVSKAAPANFLQELTLIDMKDTQHGDVEVTENDQKVAGSYYRLGKVNDKFIAIPSFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.55
4 0.57
5 0.62
6 0.61
7 0.68
8 0.67
9 0.67
10 0.62
11 0.62
12 0.66
13 0.66
14 0.75
15 0.73
16 0.75
17 0.73
18 0.81
19 0.78
20 0.78
21 0.79
22 0.75
23 0.74
24 0.7
25 0.67
26 0.58
27 0.61
28 0.59
29 0.54
30 0.53
31 0.47
32 0.44
33 0.43
34 0.48
35 0.49
36 0.45
37 0.49
38 0.45
39 0.49
40 0.55
41 0.59
42 0.61
43 0.59
44 0.62
45 0.63
46 0.7
47 0.72
48 0.68
49 0.65
50 0.64
51 0.58
52 0.56
53 0.53
54 0.49
55 0.46
56 0.44
57 0.42
58 0.36
59 0.4
60 0.36
61 0.34
62 0.32
63 0.27
64 0.25
65 0.23
66 0.21
67 0.18
68 0.16
69 0.15
70 0.12
71 0.12
72 0.11
73 0.1
74 0.1
75 0.1
76 0.1
77 0.09
78 0.08
79 0.09
80 0.09
81 0.1
82 0.11
83 0.13
84 0.16
85 0.19
86 0.25
87 0.27
88 0.35
89 0.38
90 0.41
91 0.43
92 0.44
93 0.48
94 0.44
95 0.45
96 0.41
97 0.38
98 0.35
99 0.31
100 0.3
101 0.25
102 0.26
103 0.22
104 0.27
105 0.3
106 0.34
107 0.37
108 0.36
109 0.34
110 0.33
111 0.37
112 0.32
113 0.32
114 0.37
115 0.35
116 0.33
117 0.34
118 0.33
119 0.28
120 0.26
121 0.21
122 0.14
123 0.16
124 0.15
125 0.16
126 0.16
127 0.15
128 0.14
129 0.14
130 0.14
131 0.12
132 0.15
133 0.19
134 0.2
135 0.21
136 0.24
137 0.27
138 0.26
139 0.25
140 0.22
141 0.19
142 0.18
143 0.18
144 0.15
145 0.12
146 0.1
147 0.09
148 0.14
149 0.13
150 0.15
151 0.17
152 0.22
153 0.26
154 0.28
155 0.3
156 0.33
157 0.33
158 0.32
159 0.29
160 0.23
161 0.18
162 0.18
163 0.17
164 0.09
165 0.08
166 0.08
167 0.1
168 0.09
169 0.09
170 0.08
171 0.08
172 0.09
173 0.08
174 0.09
175 0.09
176 0.1
177 0.11
178 0.11
179 0.11
180 0.11
181 0.13
182 0.16
183 0.15
184 0.17
185 0.22
186 0.24
187 0.26
188 0.27
189 0.27
190 0.29
191 0.28
192 0.27
193 0.26
194 0.24
195 0.22
196 0.25
197 0.27
198 0.23
199 0.23
200 0.22
201 0.18
202 0.19
203 0.22
204 0.22
205 0.2
206 0.24
207 0.25
208 0.26
209 0.26
210 0.26
211 0.24
212 0.2
213 0.16
214 0.12
215 0.2
216 0.24
217 0.23
218 0.23
219 0.24
220 0.26
221 0.31
222 0.37
223 0.35
224 0.34
225 0.34
226 0.36
227 0.4
228 0.38
229 0.36
230 0.31
231 0.26
232 0.22
233 0.24
234 0.26
235 0.23
236 0.25
237 0.23
238 0.22
239 0.22
240 0.21
241 0.17
242 0.13
243 0.11
244 0.1
245 0.1
246 0.08
247 0.08
248 0.08
249 0.08
250 0.08
251 0.07
252 0.08
253 0.07
254 0.07
255 0.07
256 0.09
257 0.09
258 0.11
259 0.13
260 0.13
261 0.12
262 0.13
263 0.13
264 0.11
265 0.13
266 0.13
267 0.12
268 0.14
269 0.16
270 0.16
271 0.22
272 0.22
273 0.24
274 0.3
275 0.32
276 0.34
277 0.38
278 0.4
279 0.39
280 0.4
281 0.37
282 0.32
283 0.3
284 0.28
285 0.21
286 0.19
287 0.15
288 0.13
289 0.13
290 0.12
291 0.13
292 0.12
293 0.12
294 0.12
295 0.12
296 0.11
297 0.11
298 0.1
299 0.1
300 0.09
301 0.1
302 0.1
303 0.11
304 0.14
305 0.15
306 0.17
307 0.18
308 0.21
309 0.21
310 0.21
311 0.2
312 0.19
313 0.25
314 0.29
315 0.31
316 0.34
317 0.38
318 0.43
319 0.43
320 0.4
321 0.33
322 0.28
323 0.27
324 0.23
325 0.26
326 0.27
327 0.33
328 0.37
329 0.38
330 0.37
331 0.34
332 0.35
333 0.34
334 0.3
335 0.27
336 0.28
337 0.32
338 0.37
339 0.36
340 0.34
341 0.29
342 0.26
343 0.24
344 0.19
345 0.13
346 0.09
347 0.09
348 0.1
349 0.13
350 0.14
351 0.15
352 0.15
353 0.19
354 0.19
355 0.19
356 0.16
357 0.13
358 0.14
359 0.16
360 0.19
361 0.14
362 0.14
363 0.16
364 0.17
365 0.21
366 0.22
367 0.18
368 0.18
369 0.18
370 0.19
371 0.17
372 0.19
373 0.15
374 0.18
375 0.2
376 0.18
377 0.18
378 0.18
379 0.16
380 0.15
381 0.18
382 0.15
383 0.15
384 0.19
385 0.25
386 0.3
387 0.34
388 0.36
389 0.4
390 0.45
391 0.51
392 0.49
393 0.45
394 0.4
395 0.41