Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YII5

Protein Details
Accession G8YII5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
37-56IKNTKARRRMGSRNSPQRLRHydrophilic
NLS Segment(s)
PositionSequence
41-50KARRRMGSRN
Subcellular Location(s) extr 11, mito 7, plas 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MKNFTTNGTLFMLVPAFLITSDLIASNFSRATAGGGIKNTKARRRMGSRNSPQRLRVEFERRKGSSPFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.06
4 0.05
5 0.06
6 0.05
7 0.05
8 0.05
9 0.05
10 0.06
11 0.07
12 0.07
13 0.07
14 0.07
15 0.07
16 0.07
17 0.06
18 0.07
19 0.08
20 0.09
21 0.09
22 0.1
23 0.11
24 0.12
25 0.18
26 0.21
27 0.25
28 0.29
29 0.33
30 0.39
31 0.47
32 0.56
33 0.6
34 0.67
35 0.72
36 0.78
37 0.81
38 0.78
39 0.74
40 0.72
41 0.65
42 0.61
43 0.59
44 0.6
45 0.6
46 0.64
47 0.69
48 0.63
49 0.64