Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5UCP3

Protein Details
Accession A0A1Q5UCP3   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-70GSEKVHDWKDKRKNKKRQKREAAEKEIKLSBasic
NLS Segment(s)
PositionSequence
49-64KDKRKNKKRQKREAAE
Subcellular Location(s) mito 16, extr 3, cyto_nucl 3, nucl 2.5, cyto 2.5, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSQQPGGRCYVNTLPVPLYIAIPLLLVLIPVVPVTLLWVVGSEKVHDWKDKRKNKKRQKREAAEKEIKLSANDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.27
4 0.22
5 0.17
6 0.12
7 0.11
8 0.09
9 0.08
10 0.07
11 0.05
12 0.05
13 0.04
14 0.04
15 0.03
16 0.03
17 0.03
18 0.03
19 0.02
20 0.02
21 0.04
22 0.04
23 0.04
24 0.03
25 0.04
26 0.05
27 0.06
28 0.07
29 0.06
30 0.07
31 0.11
32 0.13
33 0.18
34 0.21
35 0.3
36 0.41
37 0.5
38 0.6
39 0.67
40 0.77
41 0.83
42 0.91
43 0.93
44 0.93
45 0.95
46 0.95
47 0.96
48 0.95
49 0.94
50 0.92
51 0.84
52 0.77
53 0.69
54 0.59