Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5UB33

Protein Details
Accession A0A1Q5UB33   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-67ADLRAANEKKRQKRTRSTRRIEHKAGBasic
NLS Segment(s)
PositionSequence
49-61EKKRQKRTRSTRR
Subcellular Location(s) mito_nucl 10.165, mito 10, cyto_nucl 10, nucl 9.5
Family & Domain DBs
Amino Acid Sequences MKDLIDRRSKSPPSPLKLVVDQILKGHYKALHNTALLVKENADLRAANEKKRQKRTRSTRRIEHKAGLSIEEGLQLAQQPIQPVEADEVVSHEEVDLPNQPIQPVRRAPPTCSGCGRIGFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.61
3 0.57
4 0.55
5 0.53
6 0.47
7 0.4
8 0.34
9 0.29
10 0.29
11 0.24
12 0.22
13 0.22
14 0.21
15 0.21
16 0.24
17 0.27
18 0.27
19 0.26
20 0.27
21 0.27
22 0.26
23 0.24
24 0.2
25 0.16
26 0.15
27 0.16
28 0.15
29 0.13
30 0.11
31 0.11
32 0.21
33 0.22
34 0.25
35 0.32
36 0.4
37 0.48
38 0.59
39 0.66
40 0.64
41 0.74
42 0.8
43 0.84
44 0.86
45 0.85
46 0.83
47 0.85
48 0.84
49 0.76
50 0.69
51 0.6
52 0.53
53 0.45
54 0.37
55 0.28
56 0.21
57 0.17
58 0.13
59 0.11
60 0.07
61 0.06
62 0.06
63 0.06
64 0.06
65 0.07
66 0.07
67 0.08
68 0.08
69 0.08
70 0.08
71 0.1
72 0.1
73 0.09
74 0.08
75 0.09
76 0.1
77 0.1
78 0.09
79 0.07
80 0.08
81 0.08
82 0.1
83 0.12
84 0.13
85 0.16
86 0.17
87 0.17
88 0.21
89 0.24
90 0.29
91 0.31
92 0.34
93 0.42
94 0.44
95 0.47
96 0.53
97 0.55
98 0.54
99 0.53
100 0.52
101 0.46