Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YRW2

Protein Details
Accession G8YRW2   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-115LDSVLRKRRLKMKKHKLRKRRREQRALKKRLGKIBasic
NLS Segment(s)
PositionSequence
87-115RKRRLKMKKHKLRKRRREQRALKKRLGKI
Subcellular Location(s) mito 19.5, mito_nucl 13.833, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLRAFGLGTCIGKASSRLLSLSYRHKGNPIPSIGIHKPVLMQQPITSSILNIIQKPQGSIMEYPQTLNFEEEVDEADATIHLDSVLRKRRLKMKKHKLRKRRREQRALKKRLGKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.16
4 0.16
5 0.17
6 0.2
7 0.24
8 0.32
9 0.33
10 0.33
11 0.33
12 0.36
13 0.39
14 0.41
15 0.43
16 0.37
17 0.34
18 0.32
19 0.39
20 0.36
21 0.36
22 0.31
23 0.24
24 0.22
25 0.23
26 0.27
27 0.21
28 0.2
29 0.16
30 0.18
31 0.2
32 0.21
33 0.17
34 0.12
35 0.12
36 0.15
37 0.16
38 0.14
39 0.13
40 0.14
41 0.14
42 0.14
43 0.14
44 0.1
45 0.11
46 0.11
47 0.12
48 0.14
49 0.14
50 0.14
51 0.14
52 0.14
53 0.13
54 0.13
55 0.11
56 0.08
57 0.09
58 0.08
59 0.09
60 0.08
61 0.08
62 0.07
63 0.07
64 0.06
65 0.06
66 0.06
67 0.04
68 0.04
69 0.05
70 0.07
71 0.15
72 0.24
73 0.3
74 0.34
75 0.39
76 0.49
77 0.58
78 0.67
79 0.71
80 0.73
81 0.78
82 0.86
83 0.92
84 0.93
85 0.95
86 0.95
87 0.96
88 0.95
89 0.95
90 0.95
91 0.96
92 0.96
93 0.96
94 0.94
95 0.92