Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5SQA4

Protein Details
Accession A0A1Q5SQA4    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
62-103GKKYHILRKRRLGRVRPSRRATTSKSRGKSRRLRATTRRNLSBasic
NLS Segment(s)
PositionSequence
61-96RGKKYHILRKRRLGRVRPSRRATTSKSRGKSRRLRA
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences QPLTIAIKIITIYSRSATPWSKREEDNLLPWLKENSELPWIARPDAYLEQVGVKRSVESLRGKKYHILRKRRLGRVRPSRRATTSKSRGKSRRLRATTRRNLSSSDSSSCGNVRRWLYDIPEGALDGVKSQELPSAEASLYESRWTRESIIFQALELCALGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.2
4 0.26
5 0.31
6 0.36
7 0.41
8 0.44
9 0.45
10 0.49
11 0.5
12 0.47
13 0.46
14 0.47
15 0.42
16 0.37
17 0.37
18 0.33
19 0.26
20 0.24
21 0.2
22 0.16
23 0.18
24 0.19
25 0.19
26 0.23
27 0.24
28 0.23
29 0.22
30 0.19
31 0.19
32 0.21
33 0.21
34 0.15
35 0.14
36 0.17
37 0.19
38 0.2
39 0.16
40 0.14
41 0.13
42 0.14
43 0.15
44 0.16
45 0.23
46 0.28
47 0.35
48 0.37
49 0.38
50 0.42
51 0.49
52 0.53
53 0.54
54 0.58
55 0.58
56 0.67
57 0.75
58 0.79
59 0.79
60 0.78
61 0.79
62 0.81
63 0.83
64 0.82
65 0.78
66 0.73
67 0.69
68 0.66
69 0.62
70 0.61
71 0.6
72 0.59
73 0.59
74 0.64
75 0.65
76 0.7
77 0.73
78 0.73
79 0.74
80 0.72
81 0.76
82 0.76
83 0.81
84 0.82
85 0.79
86 0.73
87 0.63
88 0.6
89 0.56
90 0.52
91 0.44
92 0.36
93 0.31
94 0.27
95 0.27
96 0.26
97 0.24
98 0.21
99 0.24
100 0.23
101 0.23
102 0.26
103 0.26
104 0.29
105 0.3
106 0.28
107 0.23
108 0.22
109 0.2
110 0.18
111 0.16
112 0.12
113 0.08
114 0.08
115 0.06
116 0.06
117 0.07
118 0.1
119 0.1
120 0.12
121 0.13
122 0.14
123 0.14
124 0.14
125 0.17
126 0.16
127 0.16
128 0.17
129 0.17
130 0.18
131 0.2
132 0.21
133 0.22
134 0.24
135 0.28
136 0.28
137 0.33
138 0.3
139 0.29
140 0.3
141 0.26
142 0.22