Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q5SNV0

Protein Details
Accession A0A1Q5SNV0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
71-92RTGNTIRYNAKRRHWRKTRLGIHydrophilic
NLS Segment(s)
PositionSequence
81-87KRRHWRK
Subcellular Location(s) nucl 18, mito_nucl 12.833, cyto_nucl 10.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MPVSIHHHDPRTYPSATSRPSQPSPRCPENLIRPTNPPFFISQSHKTFRTKQKLAKAQRQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.39
4 0.4
5 0.39
6 0.42
7 0.46
8 0.54
9 0.54
10 0.56
11 0.62
12 0.65
13 0.61
14 0.57
15 0.58
16 0.59
17 0.61
18 0.56
19 0.5
20 0.49
21 0.51
22 0.52
23 0.46
24 0.36
25 0.3
26 0.27
27 0.29
28 0.3
29 0.32
30 0.33
31 0.35
32 0.37
33 0.38
34 0.44
35 0.49
36 0.53
37 0.52
38 0.53
39 0.6
40 0.67
41 0.72
42 0.74
43 0.75
44 0.75
45 0.77
46 0.79
47 0.75
48 0.73
49 0.71
50 0.7
51 0.63
52 0.61
53 0.62
54 0.58
55 0.57
56 0.54
57 0.51
58 0.5
59 0.53
60 0.54
61 0.49
62 0.51
63 0.52
64 0.58
65 0.63
66 0.64
67 0.66
68 0.69
69 0.73
70 0.78
71 0.82
72 0.83