Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3BCJ9

Protein Details
Accession G3BCJ9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
34-60VCVLSYVLLKRRRKRRQFISDNNQYYTHydrophilic
NLS Segment(s)
PositionSequence
43-48KRRRKR
Subcellular Location(s) extr 17, mito 7, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Gene Ontology GO:0016020  C:membrane  
KEGG cten:CANTEDRAFT_95642  -  
Pfam View protein in Pfam  
PF12273  RCR  
Amino Acid Sequences MFLPIEKRYYFYSRNHNTINRRLWLIFLIVIPLVCVLSYVLLKRRRKRRQFISDNNQYYTGAKPNQGWNFFGTGNNTQQPPYPPQAQGQYGAPGQGQNPTYPQQAYAGGTSQNYGNQQQSYQQQYQPQTGDSGYADPPPVYPAGESGTNYSRPEQPPPTAQVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.61
3 0.64
4 0.64
5 0.68
6 0.69
7 0.61
8 0.58
9 0.51
10 0.46
11 0.39
12 0.33
13 0.25
14 0.18
15 0.15
16 0.12
17 0.11
18 0.1
19 0.08
20 0.07
21 0.05
22 0.05
23 0.04
24 0.05
25 0.07
26 0.09
27 0.16
28 0.25
29 0.33
30 0.42
31 0.53
32 0.63
33 0.72
34 0.8
35 0.84
36 0.86
37 0.89
38 0.91
39 0.91
40 0.9
41 0.83
42 0.74
43 0.64
44 0.53
45 0.44
46 0.35
47 0.3
48 0.21
49 0.19
50 0.2
51 0.26
52 0.31
53 0.31
54 0.3
55 0.26
56 0.26
57 0.25
58 0.24
59 0.2
60 0.17
61 0.18
62 0.19
63 0.18
64 0.16
65 0.18
66 0.19
67 0.19
68 0.21
69 0.21
70 0.2
71 0.22
72 0.25
73 0.24
74 0.23
75 0.2
76 0.19
77 0.16
78 0.15
79 0.13
80 0.1
81 0.1
82 0.12
83 0.12
84 0.1
85 0.13
86 0.15
87 0.16
88 0.16
89 0.16
90 0.14
91 0.14
92 0.15
93 0.13
94 0.12
95 0.12
96 0.12
97 0.12
98 0.11
99 0.11
100 0.12
101 0.14
102 0.15
103 0.15
104 0.15
105 0.2
106 0.25
107 0.3
108 0.31
109 0.32
110 0.36
111 0.38
112 0.42
113 0.39
114 0.34
115 0.29
116 0.25
117 0.24
118 0.18
119 0.18
120 0.14
121 0.14
122 0.15
123 0.13
124 0.13
125 0.14
126 0.13
127 0.11
128 0.1
129 0.11
130 0.13
131 0.15
132 0.16
133 0.18
134 0.22
135 0.24
136 0.26
137 0.27
138 0.32
139 0.32
140 0.4
141 0.41
142 0.42
143 0.45