Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5SWM3

Protein Details
Accession A0A1Q5SWM3    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-61VTSHAASPEKRKKNEKKKKKSPRSGKQKLHGKQDTBasic
NLS Segment(s)
PositionSequence
34-57PEKRKKNEKKKKKSPRSGKQKLHG
Subcellular Location(s) cyto 10.5, cyto_nucl 10.333, nucl 9, mito_nucl 7.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MVQLHVATEQQVDYTVGQAFQLPKASVTSHAASPEKRKKNEKKKKKSPRSGKQKLHGKQDTEKVDGLPKETHHNARMGGEVTDPGPIPPAWPGPTTAMNPQLAVVLDNNDLLNIFYDSFLPGSSDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.1
5 0.13
6 0.13
7 0.13
8 0.17
9 0.15
10 0.15
11 0.17
12 0.18
13 0.18
14 0.21
15 0.21
16 0.19
17 0.23
18 0.25
19 0.26
20 0.35
21 0.42
22 0.47
23 0.51
24 0.6
25 0.67
26 0.76
27 0.85
28 0.86
29 0.87
30 0.9
31 0.95
32 0.96
33 0.96
34 0.95
35 0.95
36 0.95
37 0.94
38 0.91
39 0.89
40 0.88
41 0.82
42 0.81
43 0.75
44 0.67
45 0.62
46 0.61
47 0.55
48 0.47
49 0.42
50 0.32
51 0.31
52 0.27
53 0.25
54 0.19
55 0.16
56 0.2
57 0.22
58 0.25
59 0.23
60 0.24
61 0.22
62 0.22
63 0.23
64 0.18
65 0.15
66 0.12
67 0.11
68 0.1
69 0.1
70 0.09
71 0.07
72 0.08
73 0.08
74 0.08
75 0.09
76 0.12
77 0.13
78 0.14
79 0.15
80 0.17
81 0.2
82 0.22
83 0.24
84 0.26
85 0.24
86 0.24
87 0.22
88 0.2
89 0.17
90 0.16
91 0.13
92 0.1
93 0.1
94 0.11
95 0.11
96 0.09
97 0.09
98 0.09
99 0.1
100 0.09
101 0.09
102 0.08
103 0.09
104 0.1
105 0.1
106 0.1