Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5UMM8

Protein Details
Accession A0A1Q5UMM8   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
83-109DQKSEDENPQPPKKKRKIQAYDGPSRYHydrophilic
NLS Segment(s)
PositionSequence
95-98KKKR
Subcellular Location(s) nucl 10, cyto_nucl 9.5, mito 9, cyto 7
Family & Domain DBs
Amino Acid Sequences MAPNSLSAVSSLSPSNVHRSSFSEPALTPHLPMKTTAIKLDEIERWLANPELHAIDTIESSLLPSPMHIHTYTHPIPSGCKWDQKSEDENPQPPKKKRKIQAYDGPSRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.22
3 0.22
4 0.23
5 0.23
6 0.28
7 0.32
8 0.34
9 0.33
10 0.28
11 0.26
12 0.28
13 0.32
14 0.27
15 0.23
16 0.23
17 0.23
18 0.21
19 0.21
20 0.22
21 0.22
22 0.23
23 0.24
24 0.22
25 0.21
26 0.21
27 0.24
28 0.21
29 0.17
30 0.17
31 0.15
32 0.13
33 0.14
34 0.14
35 0.11
36 0.09
37 0.1
38 0.09
39 0.09
40 0.09
41 0.07
42 0.06
43 0.06
44 0.06
45 0.05
46 0.04
47 0.04
48 0.05
49 0.05
50 0.04
51 0.05
52 0.07
53 0.08
54 0.11
55 0.11
56 0.12
57 0.13
58 0.21
59 0.22
60 0.21
61 0.22
62 0.2
63 0.22
64 0.23
65 0.3
66 0.24
67 0.31
68 0.32
69 0.38
70 0.43
71 0.46
72 0.49
73 0.48
74 0.55
75 0.54
76 0.58
77 0.6
78 0.65
79 0.69
80 0.71
81 0.76
82 0.77
83 0.8
84 0.83
85 0.85
86 0.85
87 0.86
88 0.88
89 0.86