Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q5TEN4

Protein Details
Accession A0A1Q5TEN4    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
103-133VPPTPGPKTPTPKKKRAPKRKRSELEEEDEABasic
NLS Segment(s)
PositionSequence
109-124PKTPTPKKKRAPKRKR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
Amino Acid Sequences MASTKEDKDSSDDPGRDQTWFLMNVIMHTESKKLEKVRFPHKSETTRQLLTFAQLQVNWATLANQLGISKEAAAKRYERLLKSYGLNRSFQRRDGAASADGIVPPTPGPKTPTPKKKRAPKRKRSELEEEDEAKEVLDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.34
4 0.33
5 0.28
6 0.23
7 0.24
8 0.22
9 0.18
10 0.17
11 0.17
12 0.19
13 0.18
14 0.15
15 0.15
16 0.16
17 0.15
18 0.18
19 0.22
20 0.25
21 0.29
22 0.35
23 0.41
24 0.5
25 0.58
26 0.6
27 0.64
28 0.67
29 0.67
30 0.66
31 0.67
32 0.62
33 0.55
34 0.5
35 0.43
36 0.35
37 0.31
38 0.28
39 0.21
40 0.17
41 0.14
42 0.15
43 0.13
44 0.13
45 0.11
46 0.08
47 0.08
48 0.07
49 0.07
50 0.06
51 0.07
52 0.06
53 0.06
54 0.07
55 0.06
56 0.06
57 0.09
58 0.09
59 0.11
60 0.12
61 0.12
62 0.13
63 0.19
64 0.24
65 0.22
66 0.25
67 0.25
68 0.26
69 0.29
70 0.33
71 0.34
72 0.32
73 0.34
74 0.33
75 0.4
76 0.39
77 0.38
78 0.36
79 0.29
80 0.3
81 0.29
82 0.29
83 0.21
84 0.19
85 0.18
86 0.15
87 0.15
88 0.12
89 0.1
90 0.08
91 0.07
92 0.09
93 0.09
94 0.11
95 0.16
96 0.23
97 0.33
98 0.43
99 0.54
100 0.6
101 0.7
102 0.78
103 0.84
104 0.88
105 0.89
106 0.91
107 0.91
108 0.93
109 0.94
110 0.94
111 0.91
112 0.9
113 0.86
114 0.82
115 0.79
116 0.71
117 0.61
118 0.53
119 0.45
120 0.34