Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5UNV0

Protein Details
Accession A0A1Q5UNV0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
14-39WKVPWRLSSPQKARQRKRLRAVDQVVHydrophilic
78-99FDKKEKTYRKGIHKLPKWTRVSBasic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSPLLSGLLWKVPWRLSSPQKARQRKRLRAVDQVVDTLSAALARQGQSTKAVERWYAEMPREEEMLPKDKYTIFDKKEKTYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.21
5 0.23
6 0.29
7 0.35
8 0.45
9 0.52
10 0.59
11 0.67
12 0.76
13 0.79
14 0.83
15 0.85
16 0.84
17 0.86
18 0.87
19 0.82
20 0.81
21 0.78
22 0.72
23 0.63
24 0.54
25 0.43
26 0.33
27 0.27
28 0.17
29 0.12
30 0.06
31 0.04
32 0.04
33 0.06
34 0.06
35 0.07
36 0.07
37 0.08
38 0.11
39 0.12
40 0.13
41 0.13
42 0.14
43 0.13
44 0.14
45 0.16
46 0.17
47 0.18
48 0.18
49 0.19
50 0.19
51 0.2
52 0.2
53 0.18
54 0.17
55 0.18
56 0.23
57 0.2
58 0.19
59 0.19
60 0.19
61 0.22
62 0.26
63 0.32
64 0.3
65 0.38
66 0.42
67 0.49
68 0.57
69 0.62
70 0.61
71 0.63
72 0.67
73 0.69
74 0.74
75 0.76
76 0.77
77 0.77
78 0.83
79 0.82
80 0.84
81 0.79
82 0.78
83 0.79
84 0.79
85 0.8
86 0.77
87 0.79