Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8Y771

Protein Details
Accession G8Y771    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
25-44KNDPKRPKMAPNKKHRANNHBasic
NLS Segment(s)
PositionSequence
29-39KRPKMAPNKKH
Subcellular Location(s) nucl 20, cyto_nucl 13.333, mito_nucl 12.499, mito 3.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MVVSRFREPSSSPDTKRCTKSDYVKNDPKRPKMAPNKKHRANNHTSQHGGQMFCPTNASTCLFATSGMVSFEYMTQIQKHHRYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.58
3 0.62
4 0.58
5 0.55
6 0.55
7 0.61
8 0.62
9 0.64
10 0.66
11 0.7
12 0.76
13 0.79
14 0.8
15 0.76
16 0.73
17 0.67
18 0.68
19 0.69
20 0.72
21 0.72
22 0.74
23 0.79
24 0.79
25 0.83
26 0.79
27 0.76
28 0.72
29 0.72
30 0.67
31 0.6
32 0.55
33 0.48
34 0.46
35 0.4
36 0.34
37 0.25
38 0.25
39 0.22
40 0.21
41 0.21
42 0.17
43 0.15
44 0.17
45 0.18
46 0.13
47 0.13
48 0.14
49 0.13
50 0.13
51 0.12
52 0.11
53 0.1
54 0.09
55 0.09
56 0.08
57 0.08
58 0.09
59 0.11
60 0.11
61 0.12
62 0.13
63 0.17
64 0.25