Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8Y5U7

Protein Details
Accession G8Y5U7   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-43HSGTHTRDTKHTRLRRRSRPHKPRQATAKRRRSCABasic
NLS Segment(s)
PositionSequence
18-40KHTRLRRRSRPHKPRQATAKRRR
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MRAPGRRDHSGTHTRDTKHTRLRRRSRPHKPRQATAKRRRSCATQPAVTCIYRRHINDTIGSPGYTVHTLPVLRDIASAAVRHGRSLATWTAAPLGSSRPSCESVGFMFSQDTSCMCDDPLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.62
4 0.62
5 0.63
6 0.68
7 0.7
8 0.75
9 0.83
10 0.85
11 0.89
12 0.91
13 0.92
14 0.94
15 0.94
16 0.95
17 0.91
18 0.89
19 0.89
20 0.89
21 0.89
22 0.88
23 0.88
24 0.81
25 0.8
26 0.74
27 0.69
28 0.66
29 0.65
30 0.61
31 0.56
32 0.51
33 0.5
34 0.51
35 0.44
36 0.37
37 0.29
38 0.27
39 0.26
40 0.26
41 0.28
42 0.29
43 0.29
44 0.3
45 0.3
46 0.29
47 0.24
48 0.23
49 0.17
50 0.13
51 0.13
52 0.11
53 0.09
54 0.06
55 0.07
56 0.08
57 0.08
58 0.11
59 0.1
60 0.1
61 0.1
62 0.1
63 0.1
64 0.11
65 0.11
66 0.09
67 0.13
68 0.13
69 0.13
70 0.14
71 0.12
72 0.11
73 0.15
74 0.15
75 0.12
76 0.12
77 0.12
78 0.14
79 0.14
80 0.13
81 0.11
82 0.13
83 0.15
84 0.16
85 0.18
86 0.19
87 0.22
88 0.23
89 0.23
90 0.23
91 0.2
92 0.23
93 0.21
94 0.18
95 0.16
96 0.15
97 0.16
98 0.14
99 0.13
100 0.13
101 0.14
102 0.13