Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8XZ51

Protein Details
Accession G8XZ51    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
90-118GSDNKSPKKTTPRRYKPKARRTRNLNGFMHydrophilic
NLS Segment(s)
PositionSequence
95-111SPKKTTPRRYKPKARRT
Subcellular Location(s) mito 14.5, mito_nucl 12.333, nucl 9, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR006856  MATalpha_HMGbox  
Gene Ontology GO:0005634  C:nucleus  
GO:0008301  F:DNA binding, bending  
GO:0045895  P:positive regulation of mating-type specific transcription, DNA-templated  
Pfam View protein in Pfam  
PF04769  MATalpha_HMGbox  
PROSITE View protein in PROSITE  
PS51325  ALPHA_BOX  
Amino Acid Sequences MTSKRTKTVPKNLTSRFAVSGSNVCMDRRNRAAAPRSSFASDKLSSSSILFLTELPSLPSPSLELKNILLNFSSANNEFDNDEWDFFGLGSDNKSPKKTTPRRYKPKARRTRNLNGFMAFRSFYSRSISNVEHQRQLSSLLGSLWQTEPNKNIWNRYAIEYNTRATNQDFVEWLCKALSLPLDVFSIPSTSTVKNNKWLFTSNNNYNAVEDVYYAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.63
3 0.55
4 0.47
5 0.39
6 0.32
7 0.31
8 0.26
9 0.26
10 0.24
11 0.21
12 0.27
13 0.28
14 0.32
15 0.32
16 0.36
17 0.35
18 0.42
19 0.5
20 0.51
21 0.55
22 0.51
23 0.5
24 0.48
25 0.45
26 0.4
27 0.38
28 0.31
29 0.26
30 0.25
31 0.23
32 0.2
33 0.2
34 0.2
35 0.13
36 0.13
37 0.12
38 0.1
39 0.11
40 0.11
41 0.11
42 0.11
43 0.12
44 0.12
45 0.11
46 0.11
47 0.11
48 0.14
49 0.16
50 0.15
51 0.16
52 0.16
53 0.21
54 0.21
55 0.19
56 0.16
57 0.14
58 0.13
59 0.13
60 0.15
61 0.11
62 0.12
63 0.12
64 0.12
65 0.12
66 0.12
67 0.14
68 0.12
69 0.11
70 0.1
71 0.1
72 0.09
73 0.08
74 0.08
75 0.06
76 0.05
77 0.07
78 0.1
79 0.13
80 0.15
81 0.17
82 0.18
83 0.23
84 0.34
85 0.41
86 0.49
87 0.57
88 0.66
89 0.75
90 0.84
91 0.89
92 0.89
93 0.91
94 0.91
95 0.89
96 0.87
97 0.85
98 0.86
99 0.84
100 0.8
101 0.7
102 0.61
103 0.53
104 0.44
105 0.37
106 0.26
107 0.17
108 0.16
109 0.15
110 0.14
111 0.17
112 0.17
113 0.18
114 0.21
115 0.23
116 0.24
117 0.32
118 0.33
119 0.34
120 0.34
121 0.32
122 0.29
123 0.29
124 0.24
125 0.16
126 0.14
127 0.09
128 0.1
129 0.1
130 0.11
131 0.09
132 0.13
133 0.14
134 0.15
135 0.17
136 0.19
137 0.26
138 0.27
139 0.3
140 0.28
141 0.31
142 0.31
143 0.34
144 0.35
145 0.3
146 0.34
147 0.32
148 0.31
149 0.3
150 0.28
151 0.26
152 0.22
153 0.25
154 0.2
155 0.19
156 0.18
157 0.17
158 0.2
159 0.18
160 0.18
161 0.14
162 0.13
163 0.12
164 0.13
165 0.13
166 0.12
167 0.12
168 0.13
169 0.14
170 0.13
171 0.14
172 0.12
173 0.12
174 0.1
175 0.11
176 0.13
177 0.14
178 0.21
179 0.28
180 0.31
181 0.4
182 0.44
183 0.44
184 0.44
185 0.47
186 0.46
187 0.47
188 0.53
189 0.51
190 0.55
191 0.55
192 0.52
193 0.48
194 0.45
195 0.36
196 0.27