Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8YT31

Protein Details
Accession G8YT31    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
24-43GSTAKLKKKMRDIERLLKKDBasic
83-104VRFFERKKAIRRLKQAKKNLESHydrophilic
NLS Segment(s)
PositionSequence
72-107KAKKLAKRYHMVRFFERKKAIRRLKQAKKNLESAVK
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MGKSAGKARKTIGSSVKVGEALGGSTAKLKKKMRDIERLLKKDNLSADVRVVNERALKTLKNELKGSELNLKAKKLAKRYHMVRFFERKKAIRRLKQAKKNLESAVKEKGNSKVKELEELVKKYEVDLIYVVTFPKTEKYVSLYPNSEEPKMADDPKVAKGLQKTEMKRKQYREHCEKVLEEGKLSFDIDEVLKEKRMNISIQQKVPSNEEIDAPEKHEDEEEDDFFEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.44
4 0.36
5 0.33
6 0.26
7 0.18
8 0.13
9 0.12
10 0.1
11 0.08
12 0.13
13 0.18
14 0.22
15 0.3
16 0.35
17 0.41
18 0.51
19 0.61
20 0.63
21 0.69
22 0.74
23 0.76
24 0.81
25 0.8
26 0.74
27 0.69
28 0.62
29 0.55
30 0.49
31 0.43
32 0.35
33 0.3
34 0.29
35 0.26
36 0.26
37 0.24
38 0.22
39 0.19
40 0.21
41 0.2
42 0.2
43 0.2
44 0.2
45 0.21
46 0.31
47 0.33
48 0.34
49 0.34
50 0.32
51 0.35
52 0.35
53 0.35
54 0.33
55 0.32
56 0.34
57 0.35
58 0.35
59 0.34
60 0.39
61 0.41
62 0.41
63 0.45
64 0.45
65 0.51
66 0.56
67 0.62
68 0.64
69 0.63
70 0.62
71 0.66
72 0.64
73 0.63
74 0.63
75 0.59
76 0.59
77 0.66
78 0.68
79 0.66
80 0.72
81 0.75
82 0.79
83 0.82
84 0.83
85 0.82
86 0.76
87 0.73
88 0.66
89 0.61
90 0.54
91 0.47
92 0.46
93 0.37
94 0.34
95 0.31
96 0.35
97 0.38
98 0.36
99 0.36
100 0.35
101 0.34
102 0.36
103 0.35
104 0.34
105 0.31
106 0.32
107 0.31
108 0.25
109 0.25
110 0.21
111 0.24
112 0.17
113 0.13
114 0.12
115 0.11
116 0.1
117 0.1
118 0.1
119 0.06
120 0.07
121 0.06
122 0.08
123 0.08
124 0.08
125 0.09
126 0.14
127 0.19
128 0.22
129 0.26
130 0.26
131 0.25
132 0.31
133 0.32
134 0.27
135 0.23
136 0.21
137 0.2
138 0.22
139 0.22
140 0.18
141 0.18
142 0.2
143 0.23
144 0.25
145 0.21
146 0.21
147 0.23
148 0.26
149 0.31
150 0.36
151 0.38
152 0.47
153 0.55
154 0.61
155 0.65
156 0.69
157 0.72
158 0.74
159 0.79
160 0.78
161 0.77
162 0.73
163 0.7
164 0.62
165 0.6
166 0.56
167 0.45
168 0.37
169 0.3
170 0.27
171 0.24
172 0.23
173 0.16
174 0.1
175 0.11
176 0.1
177 0.12
178 0.12
179 0.13
180 0.16
181 0.16
182 0.18
183 0.22
184 0.24
185 0.25
186 0.31
187 0.4
188 0.44
189 0.48
190 0.51
191 0.51
192 0.51
193 0.52
194 0.47
195 0.39
196 0.32
197 0.3
198 0.29
199 0.28
200 0.27
201 0.26
202 0.26
203 0.24
204 0.24
205 0.23
206 0.21
207 0.22
208 0.26
209 0.24