Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5URJ5

Protein Details
Accession A0A1Q5URJ5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
87-106EKPRSSSSRRYRDEVRRPAKBasic
NLS Segment(s)
Subcellular Location(s) extr 18, plas 4, golg 2, cyto 1, pero 1, E.R. 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPTSSHITPRDSNGCPSNLTGGAIAGIVIGSIFGTLLLIWLWRFLQLPWGSDDRSDVGYRPPITRTAAGDDRRRRRRSSNVDYYVEKPRSSSSRRYRDEVRRPAKVYLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.36
4 0.34
5 0.31
6 0.25
7 0.23
8 0.18
9 0.13
10 0.12
11 0.1
12 0.09
13 0.05
14 0.04
15 0.03
16 0.03
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.05
30 0.05
31 0.06
32 0.06
33 0.13
34 0.14
35 0.15
36 0.17
37 0.19
38 0.18
39 0.18
40 0.19
41 0.12
42 0.13
43 0.13
44 0.1
45 0.11
46 0.15
47 0.17
48 0.17
49 0.17
50 0.17
51 0.19
52 0.21
53 0.2
54 0.22
55 0.27
56 0.31
57 0.39
58 0.46
59 0.54
60 0.62
61 0.65
62 0.63
63 0.64
64 0.7
65 0.72
66 0.73
67 0.73
68 0.71
69 0.71
70 0.69
71 0.66
72 0.64
73 0.56
74 0.46
75 0.36
76 0.34
77 0.38
78 0.4
79 0.47
80 0.48
81 0.56
82 0.61
83 0.66
84 0.71
85 0.74
86 0.8
87 0.8
88 0.78
89 0.76
90 0.75