Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5UF15

Protein Details
Accession A0A1Q5UF15    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-24KKHVPIVKKHTNRFFRHQSDBasic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 8.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKHTNRFFRHQSDRFMRVGASWRKPKGIDNCVRRRFKGVIRMPKIGYGSNKKTRHMMPSGHKAFLVHNPKDVELLLMHNRTYAAEIAHAVSSRKRVEIVAKAKALGVKVTNAKGRVTTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.79
4 0.8
5 0.8
6 0.78
7 0.8
8 0.76
9 0.75
10 0.73
11 0.7
12 0.62
13 0.53
14 0.44
15 0.35
16 0.39
17 0.38
18 0.39
19 0.43
20 0.44
21 0.46
22 0.47
23 0.52
24 0.52
25 0.54
26 0.54
27 0.56
28 0.65
29 0.71
30 0.74
31 0.68
32 0.64
33 0.58
34 0.54
35 0.55
36 0.53
37 0.54
38 0.55
39 0.58
40 0.54
41 0.52
42 0.48
43 0.4
44 0.37
45 0.34
46 0.37
47 0.42
48 0.44
49 0.42
50 0.45
51 0.44
52 0.44
53 0.4
54 0.39
55 0.36
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.32
62 0.35
63 0.36
64 0.26
65 0.28
66 0.29
67 0.29
68 0.29
69 0.27
70 0.2
71 0.12
72 0.15
73 0.15
74 0.15
75 0.15
76 0.15
77 0.15
78 0.14
79 0.15
80 0.12
81 0.08
82 0.08
83 0.09
84 0.1
85 0.11
86 0.11
87 0.11
88 0.12
89 0.17
90 0.18
91 0.18
92 0.18
93 0.19
94 0.24
95 0.33
96 0.37
97 0.39
98 0.39
99 0.39
100 0.39
101 0.39
102 0.34
103 0.28
104 0.23
105 0.21
106 0.25
107 0.3
108 0.34
109 0.34
110 0.34
111 0.34