Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5UAB9

Protein Details
Accession A0A1Q5UAB9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
145-172LEGHDLSSEKPRRRKPWEKDVQEKEPVQHydrophilic
NLS Segment(s)
PositionSequence
157-157R
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MTEAQSPSSFEQLKAYPFTSDPEFANGLAIILGHAGTPASEAEMSRDDDLVLQAKCFFFSRKQKITPPINFATYKAWLTGASSESNAATAVSEQPHEPSTETTVASTESSTSAEPAYPTSFAHIVELITTGQPIPGIQQIPDTVLEGHDLSSEKPRRRKPWEKDVQEKEPVQEEMASNAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.25
4 0.24
5 0.27
6 0.26
7 0.25
8 0.23
9 0.23
10 0.23
11 0.21
12 0.21
13 0.17
14 0.13
15 0.11
16 0.1
17 0.06
18 0.05
19 0.05
20 0.03
21 0.04
22 0.03
23 0.03
24 0.04
25 0.04
26 0.05
27 0.06
28 0.06
29 0.09
30 0.11
31 0.13
32 0.13
33 0.13
34 0.12
35 0.12
36 0.13
37 0.15
38 0.13
39 0.11
40 0.12
41 0.12
42 0.13
43 0.14
44 0.15
45 0.19
46 0.3
47 0.39
48 0.44
49 0.48
50 0.53
51 0.62
52 0.69
53 0.65
54 0.61
55 0.55
56 0.52
57 0.48
58 0.42
59 0.36
60 0.29
61 0.25
62 0.18
63 0.16
64 0.12
65 0.12
66 0.13
67 0.11
68 0.09
69 0.09
70 0.09
71 0.09
72 0.09
73 0.08
74 0.06
75 0.05
76 0.04
77 0.05
78 0.06
79 0.06
80 0.06
81 0.07
82 0.08
83 0.09
84 0.09
85 0.09
86 0.11
87 0.12
88 0.12
89 0.11
90 0.11
91 0.11
92 0.11
93 0.1
94 0.07
95 0.06
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.08
103 0.09
104 0.09
105 0.09
106 0.11
107 0.12
108 0.11
109 0.12
110 0.11
111 0.09
112 0.09
113 0.1
114 0.08
115 0.07
116 0.07
117 0.06
118 0.06
119 0.06
120 0.05
121 0.06
122 0.1
123 0.1
124 0.1
125 0.12
126 0.13
127 0.14
128 0.15
129 0.14
130 0.11
131 0.1
132 0.12
133 0.1
134 0.1
135 0.1
136 0.11
137 0.11
138 0.2
139 0.28
140 0.34
141 0.43
142 0.53
143 0.61
144 0.71
145 0.8
146 0.8
147 0.83
148 0.87
149 0.87
150 0.89
151 0.88
152 0.85
153 0.82
154 0.74
155 0.66
156 0.6
157 0.51
158 0.42
159 0.36
160 0.29