Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5TED5

Protein Details
Accession A0A1Q5TED5    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
83-110STKTRSAKSGRVQKQPRNRKTRPSIVFSHydrophilic
NLS Segment(s)
PositionSequence
86-124TRSAKSGRVQKQPRNRKTRPSIVFSKPVSKNKKGGPKRK
Subcellular Location(s) nucl 16, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSVRASVSKRNRANLRKTVFGPIVDARTERLAAKLQEIASQPKPEAPKKKEMDIEADETADQNDAEKATPVGEEMDIDNKSTKTRSAKSGRVQKQPRNRKTRPSIVFSKPVSKNKKGGPKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.79
4 0.73
5 0.69
6 0.66
7 0.64
8 0.56
9 0.47
10 0.42
11 0.35
12 0.33
13 0.27
14 0.26
15 0.2
16 0.19
17 0.2
18 0.16
19 0.15
20 0.17
21 0.16
22 0.18
23 0.2
24 0.18
25 0.21
26 0.23
27 0.26
28 0.25
29 0.26
30 0.24
31 0.24
32 0.29
33 0.32
34 0.4
35 0.39
36 0.46
37 0.47
38 0.52
39 0.53
40 0.49
41 0.48
42 0.4
43 0.4
44 0.3
45 0.27
46 0.22
47 0.18
48 0.17
49 0.11
50 0.08
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.06
61 0.05
62 0.06
63 0.06
64 0.1
65 0.1
66 0.11
67 0.12
68 0.12
69 0.13
70 0.13
71 0.18
72 0.21
73 0.24
74 0.33
75 0.39
76 0.47
77 0.55
78 0.65
79 0.68
80 0.72
81 0.77
82 0.77
83 0.8
84 0.84
85 0.85
86 0.85
87 0.82
88 0.82
89 0.83
90 0.85
91 0.8
92 0.77
93 0.75
94 0.71
95 0.74
96 0.67
97 0.67
98 0.65
99 0.68
100 0.69
101 0.66
102 0.67
103 0.67
104 0.75