Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8Y6M7

Protein Details
Accession G8Y6M7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
167-190RDSTKRLQKIYKERKKIVSNFNSLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 13.833, cyto 10.5, mito_nucl 8.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR010776  Hop2_WH_dom  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0090304  P:nucleic acid metabolic process  
Pfam View protein in Pfam  
PF07106  TBPIP  
Amino Acid Sequences MVKKKEGAVQALKGEEAEDLVKEYLKNQYRPYSATDLVQNLHNRVNKANMAKCLEVLVASGDVVSKTYGKQVYYVYKEEQVDEEKSQRFSPETISELNERVEALREETKKLQEAEYDSLVATPTNESAMLQVDELKEGNKTLQAKAEELQKNQGECTVTKEDVERARDSTKRLQKIYKERKKIVSNFNSLSVYDLLAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.2
3 0.16
4 0.12
5 0.08
6 0.1
7 0.1
8 0.12
9 0.11
10 0.13
11 0.21
12 0.27
13 0.31
14 0.34
15 0.42
16 0.43
17 0.45
18 0.49
19 0.47
20 0.41
21 0.39
22 0.37
23 0.32
24 0.3
25 0.33
26 0.3
27 0.25
28 0.3
29 0.31
30 0.28
31 0.28
32 0.32
33 0.31
34 0.35
35 0.38
36 0.38
37 0.38
38 0.37
39 0.35
40 0.32
41 0.27
42 0.2
43 0.16
44 0.11
45 0.07
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.06
52 0.05
53 0.06
54 0.11
55 0.13
56 0.13
57 0.15
58 0.18
59 0.24
60 0.27
61 0.3
62 0.27
63 0.3
64 0.3
65 0.28
66 0.27
67 0.23
68 0.22
69 0.2
70 0.23
71 0.21
72 0.22
73 0.22
74 0.21
75 0.19
76 0.17
77 0.18
78 0.16
79 0.16
80 0.16
81 0.17
82 0.17
83 0.17
84 0.17
85 0.13
86 0.11
87 0.09
88 0.09
89 0.08
90 0.1
91 0.14
92 0.15
93 0.17
94 0.2
95 0.21
96 0.22
97 0.23
98 0.21
99 0.18
100 0.21
101 0.21
102 0.19
103 0.18
104 0.15
105 0.14
106 0.14
107 0.11
108 0.08
109 0.06
110 0.05
111 0.05
112 0.05
113 0.05
114 0.06
115 0.07
116 0.07
117 0.07
118 0.09
119 0.08
120 0.09
121 0.09
122 0.09
123 0.08
124 0.08
125 0.09
126 0.11
127 0.13
128 0.13
129 0.19
130 0.2
131 0.21
132 0.23
133 0.32
134 0.32
135 0.32
136 0.38
137 0.36
138 0.35
139 0.34
140 0.34
141 0.26
142 0.22
143 0.27
144 0.25
145 0.23
146 0.23
147 0.24
148 0.27
149 0.31
150 0.34
151 0.3
152 0.28
153 0.33
154 0.35
155 0.39
156 0.44
157 0.48
158 0.52
159 0.55
160 0.59
161 0.64
162 0.72
163 0.79
164 0.79
165 0.8
166 0.79
167 0.83
168 0.85
169 0.84
170 0.84
171 0.81
172 0.79
173 0.72
174 0.69
175 0.61
176 0.51
177 0.46
178 0.35