Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8Y3W5

Protein Details
Accession G8Y3W5    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
89-108VALLRCLWRITQKKKRPRAWHydrophilic
NLS Segment(s)
PositionSequence
101-106KKKRPR
Subcellular Location(s) mito 12, cyto 7, nucl 4, pero 2
Family & Domain DBs
Amino Acid Sequences MPNVAIGTHCTPQAAKFSLQAPSALVRYYLLHGCPFQIPPGCRTYHEYVVVSARRFIQSPETLLLVQSVSVGGVGSFCGRCPPLAAIIVALLRCLWRITQKKKRPRAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.22
4 0.24
5 0.27
6 0.27
7 0.26
8 0.21
9 0.2
10 0.2
11 0.17
12 0.15
13 0.11
14 0.12
15 0.14
16 0.14
17 0.13
18 0.14
19 0.14
20 0.15
21 0.16
22 0.15
23 0.15
24 0.19
25 0.19
26 0.2
27 0.23
28 0.23
29 0.23
30 0.28
31 0.3
32 0.29
33 0.3
34 0.28
35 0.25
36 0.29
37 0.3
38 0.24
39 0.2
40 0.18
41 0.16
42 0.16
43 0.15
44 0.16
45 0.15
46 0.16
47 0.16
48 0.16
49 0.15
50 0.15
51 0.15
52 0.09
53 0.08
54 0.06
55 0.05
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.05
63 0.05
64 0.05
65 0.08
66 0.08
67 0.09
68 0.11
69 0.12
70 0.13
71 0.15
72 0.15
73 0.13
74 0.14
75 0.15
76 0.12
77 0.11
78 0.08
79 0.07
80 0.08
81 0.09
82 0.1
83 0.18
84 0.29
85 0.39
86 0.51
87 0.61
88 0.71