Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q5U0P1

Protein Details
Accession A0A1Q5U0P1   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
66-86ELPTKRDSKQRYEEKKDQVNLHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 16, cyto 5, nucl 3, mito 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MAHGVFTIPASGAGVEHPFNSARDAYHYRTVRLNETAVQDLMMYRCISKSEVDTTNLAAGSGEGEELPTKRDSKQRYEEKKDQVNLPGSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.11
5 0.11
6 0.12
7 0.14
8 0.13
9 0.12
10 0.18
11 0.22
12 0.25
13 0.33
14 0.33
15 0.33
16 0.37
17 0.38
18 0.35
19 0.33
20 0.3
21 0.24
22 0.25
23 0.25
24 0.2
25 0.18
26 0.14
27 0.13
28 0.12
29 0.1
30 0.08
31 0.06
32 0.07
33 0.07
34 0.08
35 0.09
36 0.1
37 0.14
38 0.16
39 0.17
40 0.18
41 0.18
42 0.18
43 0.17
44 0.15
45 0.1
46 0.08
47 0.06
48 0.06
49 0.05
50 0.04
51 0.04
52 0.06
53 0.06
54 0.09
55 0.11
56 0.12
57 0.16
58 0.24
59 0.29
60 0.37
61 0.47
62 0.56
63 0.64
64 0.73
65 0.78
66 0.8
67 0.84
68 0.8
69 0.74
70 0.71