Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q5TXS7

Protein Details
Accession A0A1Q5TXS7    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
106-126WAEVVHRTMTKKKKKKKKKKSBasic
NLS Segment(s)
PositionSequence
116-126KKKKKKKKKKS
Subcellular Location(s) mito 12.5, mito_nucl 7.833, cyto 5.5, E.R. 5, cyto_nucl 4.333, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039757  EIF2D  
IPR001950  SUI1  
IPR036877  SUI1_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0003743  F:translation initiation factor activity  
GO:0001731  P:formation of translation preinitiation complex  
Pfam View protein in Pfam  
PF01253  SUI1  
PROSITE View protein in PROSITE  
PS50296  SUI1  
Amino Acid Sequences MVSHLAKSAVGGQTLAGVKPKAGASPKALIALEKRTGSKIVMVTNLEIFVIIPSLLVEELQKKCASSTSVTQAAGAPKGAMEVLVQEDQRKVIDAALASRGLKSQWAEVVHRTMTKKKKKKKKKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.16
4 0.14
5 0.14
6 0.17
7 0.17
8 0.17
9 0.2
10 0.23
11 0.24
12 0.28
13 0.29
14 0.29
15 0.28
16 0.25
17 0.24
18 0.26
19 0.25
20 0.23
21 0.23
22 0.22
23 0.23
24 0.22
25 0.23
26 0.2
27 0.18
28 0.19
29 0.19
30 0.18
31 0.17
32 0.17
33 0.13
34 0.1
35 0.08
36 0.05
37 0.05
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.09
46 0.1
47 0.12
48 0.12
49 0.12
50 0.12
51 0.14
52 0.15
53 0.12
54 0.14
55 0.17
56 0.2
57 0.2
58 0.2
59 0.2
60 0.19
61 0.18
62 0.15
63 0.1
64 0.07
65 0.07
66 0.07
67 0.05
68 0.04
69 0.04
70 0.07
71 0.09
72 0.09
73 0.1
74 0.11
75 0.11
76 0.12
77 0.12
78 0.1
79 0.09
80 0.11
81 0.1
82 0.11
83 0.13
84 0.14
85 0.13
86 0.13
87 0.13
88 0.11
89 0.14
90 0.14
91 0.14
92 0.17
93 0.2
94 0.23
95 0.25
96 0.29
97 0.29
98 0.32
99 0.34
100 0.39
101 0.46
102 0.55
103 0.62
104 0.69
105 0.78
106 0.84