Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q5T8Q3

Protein Details
Accession A0A1Q5T8Q3    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
50-73GSGSHSSPKKRRKVNHGKVPFARYHydrophilic
NLS Segment(s)
PositionSequence
57-65PKKRRKVNH
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 8
Family & Domain DBs
Amino Acid Sequences MTEKSASGSGAISDKTAAAAKFKASAGDAGKDARAKDSPAASAVKSETAGSGSHSSPKKRRKVNHGKVPFARYATGIFGRKPSVPGSHGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.14
4 0.12
5 0.12
6 0.13
7 0.14
8 0.16
9 0.16
10 0.16
11 0.14
12 0.17
13 0.17
14 0.17
15 0.17
16 0.15
17 0.17
18 0.18
19 0.17
20 0.16
21 0.15
22 0.14
23 0.16
24 0.16
25 0.15
26 0.15
27 0.16
28 0.14
29 0.14
30 0.13
31 0.11
32 0.1
33 0.09
34 0.07
35 0.07
36 0.07
37 0.08
38 0.1
39 0.1
40 0.16
41 0.2
42 0.25
43 0.33
44 0.42
45 0.49
46 0.55
47 0.63
48 0.68
49 0.76
50 0.81
51 0.84
52 0.83
53 0.83
54 0.8
55 0.78
56 0.7
57 0.6
58 0.5
59 0.4
60 0.33
61 0.29
62 0.29
63 0.27
64 0.24
65 0.26
66 0.28
67 0.28
68 0.29
69 0.28
70 0.27